DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GSTO1 and GstD3

DIOPT Version :9

Sequence 1:NP_004823.1 Gene:GSTO1 / 9446 HGNCID:13312 Length:241 Species:Homo sapiens
Sequence 2:NP_788656.1 Gene:GstD3 / 48336 FlyBaseID:FBgn0010039 Length:199 Species:Drosophila melanogaster


Alignment Length:206 Identity:51/206 - (24%)
Similarity:91/206 - (44%) Gaps:36/206 - (17%)


- Green bases have known domain annotations that are detailed below.


Human    40 LVLKAKGI--RHEVININLKNK---PEWFFKKNPFGLVPVLENSQGQLIYESAITCEYLDEAYPG 99
            :|.||.|:  ..::|| .||.:   |: |.|.||...:|.|.:: |..|:||.....||.|.| |
  Fly     1 MVGKALGLEFNKKIIN-TLKGEQMNPD-FIKINPQHSIPTLVDN-GFTIWESRAILVYLVEKY-G 61

Human   100 K--KLLPDDPYEKAC--QKMILELFSKVPSLVGSFIRS------QNKEDYAGLKEEFRKEFTKLE 154
            |  .|.|.|..::|.  |::..::....|:|...:.::      .::|||..::|.|....|.||
  Fly    62 KDDALYPKDIQKQAVINQRLYFDMALMYPTLANYYYKAFTTGQFGSEEDYKKVQETFDFLNTFLE 126

Human   155 EVLTNKKTTFFGGNSISMIDYLIWPWFERLEAMKLNECVDHTPKLKLWMAAMKEDPTVSALLTS- 218
                  ...:..|:..::.|..|.......:.:..:  :...|.:..|...:|:       :|. 
  Fly   127 ------GQDYVAGDQYTVADIAILANVSNFDVVGFD--ISKYPNVARWYDHVKK-------ITPG 176

Human   219 -EKDWQGFLEL 228
             |::|.|.|::
  Fly   177 WEENWAGALDV 187

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GSTO1NP_004823.1 GST_N_Omega 5..94 CDD:239353 20/58 (34%)