DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GSTO1 and GstD1

DIOPT Version :9

Sequence 1:NP_004823.1 Gene:GSTO1 / 9446 HGNCID:13312 Length:241 Species:Homo sapiens
Sequence 2:NP_001034042.1 Gene:GstD1 / 41503 FlyBaseID:FBgn0001149 Length:209 Species:Drosophila melanogaster


Alignment Length:203 Identity:52/203 - (25%)
Similarity:81/203 - (39%) Gaps:30/203 - (14%)


- Green bases have known domain annotations that are detailed below.


Human    40 LVLKAKGIRHEVININLKN-------KPEWFFKKNPFGLVPVLENSQGQLIYESAITCEYLDEAY 97
            :::.||.:..| :|..|.|       ||| |.|.||...:|.|.:: |..::||.....||.|.|
  Fly    16 VIMTAKAVGVE-LNKKLLNLQAGEHLKPE-FLKINPQHTIPTLVDN-GFALWESRAIQVYLVEKY 77

Human    98 PGK--KLLPDDPYEKACQKMILELFSKVPSLVGSFIRSQNKEDYAGLKEEFRKEFTKLEEVLTNK 160
             ||  .|.|..|.::|....  .|:..:.:|..||......:.:|....: .:.|.|:|......
  Fly    78 -GKTDSLYPKCPKKRAVINQ--RLYFDMGTLYQSFANYYYPQVFAKAPAD-PEAFKKIEAAFEFL 138

Human   161 KTTFFG-----GNSISMIDYLIWPWFERLEAMKLNECVDHTPKLKLWMA-AMKEDPTVSALLTSE 219
            .|...|     |:|:::.|..:.......|..|..  :.....:..|.. |.|..|      ..|
  Fly   139 NTFLEGQDYAAGDSLTVADIALVATVSTFEVAKFE--ISKYANVNRWYENAKKVTP------GWE 195

Human   220 KDWQGFLE 227
            ::|.|.||
  Fly   196 ENWAGCLE 203

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GSTO1NP_004823.1 GST_N_Omega 5..94 CDD:239353 19/60 (32%)