DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GSTO1 and GstO1

DIOPT Version :9

Sequence 1:NP_004823.1 Gene:GSTO1 / 9446 HGNCID:13312 Length:241 Species:Homo sapiens
Sequence 2:NP_648237.1 Gene:GstO1 / 38975 FlyBaseID:FBgn0035907 Length:254 Species:Drosophila melanogaster


Alignment Length:236 Identity:88/236 - (37%)
Similarity:118/236 - (50%) Gaps:43/236 - (18%)


- Green bases have known domain annotations that are detailed below.


Human     1 MSGESARSLGKGSAPPGPV--PEGSIRIYSMRFCPFAERTRLVLKAKGIRHEVININLKNKPEWF 63
            ||.....::|.    |.||  .:|.:::|||||||:|.|..|||.||.|.:..|.|||::|||||
  Fly     1 MSNTQHLTIGS----PKPVFPDDGILKLYSMRFCPYAHRVHLVLDAKKIPYHAIYINLRDKPEWF 61

Human    64 FKKNPFGLVPVLE--NSQGQ-LIYESAITCEYLDEAYPGKKLLPDDPYEKACQKMILELFSKVPS 125
            ...:....||.||  ..||. ::.||.|.|:||||.||...|.|.|..:||.:|:::|.|     
  Fly    62 SLVSSSTKVPALELVKEQGNPVLIESLIICDYLDEKYPEVPLYPKDLLKKAQEKILIERF----- 121

Human   126 LVGSFIRS-------QNKED------YAGLKEEFRKEFTKLEEVLTNKKTTFFGGNSISMIDYLI 177
              |.||.:       .|.|.      ||||        ...||.|..:.|.||||:|..|:||::
  Fly   122 --GQFINAFYYLLLHDNPEQLVDTDHYAGL--------VVYEEELKRRCTKFFGGDSPGMLDYMM 176

Human   178 WPWFERLEAM------KLNECVDHTPKLKLWMAAMKEDPTV 212
            |||.||.:::      |.....:..|.|..|...|.:|..|
  Fly   177 WPWCERFDSLKYTFEQKFELSPERFPTLIKWRDLMIQDRAV 217

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GSTO1NP_004823.1 GST_N_Omega 5..94 CDD:239353 40/93 (43%)