DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GSTO1 and se

DIOPT Version :9

Sequence 1:NP_004823.1 Gene:GSTO1 / 9446 HGNCID:13312 Length:241 Species:Homo sapiens
Sequence 2:NP_648235.1 Gene:se / 38973 FlyBaseID:FBgn0086348 Length:243 Species:Drosophila melanogaster


Alignment Length:219 Identity:95/219 - (43%)
Similarity:124/219 - (56%) Gaps:16/219 - (7%)


- Green bases have known domain annotations that are detailed below.


Human     5 SARSLGKGSAPPGPVPEGSIRIYSMRFCPFAERTRLVLKAKGIRHEVININLKNKPEWFFKKNPF 69
            :.|.|.|||..|....:|.:|:|||||||||:|..|||.||.|.:..|.|||.:||||..:|||.
  Fly     3 NGRHLAKGSPMPDVPEDGILRLYSMRFCPFAQRVHLVLDAKQIPYHSIYINLTDKPEWLLEKNPQ 67

Human    70 GLVPVLE--NSQG-QLIYESAITCEYLDEAYPGKKLLPDDPYEKACQKMILELFSKVPSLVGSFI 131
            |.||.||  ...| .::.||.:.||||||.||.:.|.|.||.:|...|:::|.|..|   :|:|.
  Fly    68 GKVPALEIVREPGPPVLTESLLICEYLDEQYPLRPLYPRDPLKKVQDKLLIERFRAV---LGAFF 129

Human   132 RSQNKEDYAGLKEEFRKEFTKLEEVLTNKKTTFFGGNSISMIDYLIWPWFERLEAMKLNECVDHT 196
            ::.:..|.    |.|.......|..|..:.|.||||....::||:||||.||||.:||....|:.
  Fly   130 KASDGGDL----EPFWSGLDIYERELARRGTEFFGGEQTGILDYMIWPWCERLELLKLQRGEDYN 190

Human   197 ------PKLKLWMAAMKEDPTVSA 214
                  |:|.||:..||.||.|.|
  Fly   191 YDQSRFPQLTLWLERMKRDPAVMA 214

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GSTO1NP_004823.1 GST_N_Omega 5..94 CDD:239353 46/91 (51%)