DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GSTO1 and GstE12

DIOPT Version :9

Sequence 1:NP_004823.1 Gene:GSTO1 / 9446 HGNCID:13312 Length:241 Species:Homo sapiens
Sequence 2:NP_001246500.1 Gene:GstE12 / 37960 FlyBaseID:FBgn0027590 Length:223 Species:Drosophila melanogaster


Alignment Length:212 Identity:53/212 - (25%)
Similarity:81/212 - (38%) Gaps:48/212 - (22%)


- Green bases have known domain annotations that are detailed below.


Human    26 IYSMRFCPFAERTRLVLKAKGIRHEVININLKN----KPEWFFKKNPFGLVPVLENSQGQLIYES 86
            :|.....|.:....|..||.|:..|:..|||..    .|| |.|.||...:|.|.:.:..:|...
  Fly     6 LYYATLSPPSRAVLLTAKAIGLDLELRPINLLKGEHLTPE-FLKLNPQHTIPTLIDGEATIIDSH 69

Human    87 AITCEYLDEAYPGK--KLLPDDPYEKACQKMIL-----ELFSKVPSL------VGSFIRSQNKED 138
            || |.||.|.|..|  :|.|.:..::|.....|     .||:::..|      .||...|.:|..
  Fly    70 AI-CAYLVEKYGQKEQQLYPKELVQRANVDARLHLDSGHLFARLRFLYEPILYYGSTDCSIDKIA 133

Human   139 YAGLKEEFRKEFTKLEEVLTN--KKTTFFGGNSISMIDYLIWPWFERLEAMKLNECVDHT----- 196
            |          ..|..|:|..  |...:..|:.:::.|:.         |:.....|:.|     
  Fly   134 Y----------IQKCWEILEGFLKDQPYLCGSDLTIADFC---------AVATVTSVNDTAPIDE 179

Human   197 ---PKLKLWMAAMKEDP 210
               ||:..|:..:.|.|
  Fly   180 FKFPKMHAWLKRLAELP 196

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GSTO1NP_004823.1 GST_N_Omega 5..94 CDD:239353 23/71 (32%)