DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GSTO1 and GstE7

DIOPT Version :9

Sequence 1:NP_004823.1 Gene:GSTO1 / 9446 HGNCID:13312 Length:241 Species:Homo sapiens
Sequence 2:NP_611329.1 Gene:GstE7 / 37112 FlyBaseID:FBgn0063493 Length:223 Species:Drosophila melanogaster


Alignment Length:200 Identity:53/200 - (26%)
Similarity:88/200 - (44%) Gaps:24/200 - (12%)


- Green bases have known domain annotations that are detailed below.


Human    26 IYSMRFCPFAERTRLVLKAKGIRHEVININLK---NKPEWFFKKNPFGLVPVLENSQGQLIYESA 87
            :|.:...|.....:|.|.|..:.:|.:.:|.:   |..|.|.||||...||.||: .|..|::|.
  Fly     6 LYGLEASPPVRAVKLTLAALEVPYEFVEVNTRAKENFSEEFLKKNPQHTVPTLED-DGHYIWDSH 69

Human    88 ITCEYLDEAYPGK--KLLPDDPYEKACQKMILELFSKVPSLVGSFIRSQNKEDYAGLKEEFRKE- 149
            ....||...| ||  .|.|.|..::|.....|...|.|  :..:.:||..|..:||.:....|| 
  Fly    70 AIIAYLVSKY-GKTDSLYPKDLLQRAVVDQRLHFESGV--IFANALRSITKPLFAGKQTMIPKER 131

Human   150 -------FTKLEEVLTNKKTTFFGGNSISMIDYLIWPWFERLEAMKLNECVDHT--PKLKLWMAA 205
                   :..||:.|..  ..:..||.:::.|:.|   ...:.::::...||.|  |::..|...
  Fly   132 YDAIIEVYDFLEKFLAG--NDYVAGNQLTIADFSI---ISTVSSLEVFVKVDTTKYPRIAAWFKR 191

Human   206 MKEDP 210
            :::.|
  Fly   192 LQKLP 196

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GSTO1NP_004823.1 GST_N_Omega 5..94 CDD:239353 22/70 (31%)