DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GSTO1 and GstE6

DIOPT Version :9

Sequence 1:NP_004823.1 Gene:GSTO1 / 9446 HGNCID:13312 Length:241 Species:Homo sapiens
Sequence 2:NP_611328.1 Gene:GstE6 / 37111 FlyBaseID:FBgn0063494 Length:222 Species:Drosophila melanogaster


Alignment Length:208 Identity:51/208 - (24%)
Similarity:90/208 - (43%) Gaps:36/208 - (17%)


- Green bases have known domain annotations that are detailed below.


Human    24 IRIYSMRFCPFAERTRLVLKAKGIRHEVININL----KNKPEWFFKKNPFGLVPVLENSQGQLIY 84
            :.:|.:...|.....:|.|.|..:.:|.:|:::    :..|| :.:|||...||.||: .|..|:
  Fly     4 LTLYGLDPSPPVRAVKLTLAALNLTYEYVNVDIVARAQLSPE-YLEKNPQHTVPTLED-DGHYIW 66

Human    85 ESAITCEYLDEAY-PGKKLLPDDPYEKACQKMILELFSKVPSLVGSFIRSQN------------K 136
            :|.....||...| ....|.|.||.::|.....|...|.|  :..:.|||.:            |
  Fly    67 DSHAIIAYLVSKYADSDALYPKDPLKRAVVDQRLHFESGV--VFANGIRSISKSVLFQGQTKVPK 129

Human   137 EDYAGLKE--EFRKEFTKLEEVLTNKKTTFFGGNSISMIDYLIWPWFERLEAMKLNECVDHT--P 197
            |.|..:.|  :|.:.|.|.::        :..||.:::.|:.:......|||.   ..:|.|  |
  Fly   130 ERYDAIIEIYDFVETFLKGQD--------YIAGNQLTIADFSLVSSVASLEAF---VALDTTKYP 183

Human   198 KLKLWMAAMKEDP 210
            ::..|:..:::.|
  Fly   184 RIGAWIKKLEQLP 196

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GSTO1NP_004823.1 GST_N_Omega 5..94 CDD:239353 20/73 (27%)