DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GSTO1 and GstE4

DIOPT Version :9

Sequence 1:NP_004823.1 Gene:GSTO1 / 9446 HGNCID:13312 Length:241 Species:Homo sapiens
Sequence 2:NP_611326.1 Gene:GstE4 / 37109 FlyBaseID:FBgn0063496 Length:222 Species:Drosophila melanogaster


Alignment Length:211 Identity:54/211 - (25%)
Similarity:85/211 - (40%) Gaps:38/211 - (18%)


- Green bases have known domain annotations that are detailed below.


Human    22 GSIRIYSMRFCPFAERTRLVLKAKGIRHEVININL---KNKPEWFFKKNPFGLVPVLENSQGQLI 83
            |.|.:|.:...|......|.|||..:..|.:.:||   :|..|.|.||||...||:|::... .|
  Fly     2 GKISLYGLDASPPTRACLLTLKALDLPFEFVFVNLFEKENFSEDFSKKNPQHTVPLLQDDDA-CI 65

Human    84 YESAITCEYLDEAY-PGKKLLPDDPYEKACQKMILELFSKV-----------PSL-VGSFIRSQN 135
            ::|.....||.|.| |..:|.|.|..::|....::...|.|           |.| .|.....:|
  Fly    66 WDSHAIMAYLVEKYAPSDELYPKDLLQRAKVDQLMHFESGVIFESALRRLTRPVLFFGEPTLPRN 130

Human   136 KEDYAGLKEEFRKEFTKLEEVLTNKKTTFFGGNSISMIDYLIWPW------FERLEAMKLNECVD 194
            :.|:.....:|.:.|....:        |..|:.:::.|:.|...      |..|:..|.     
  Fly   131 QVDHILQVYDFVETFLDDHD--------FVAGDQLTIADFSIVSTITSIGVFLELDPAKY----- 182

Human   195 HTPKLKLWMAAMKEDP 210
              ||:..|:..:||.|
  Fly   183 --PKIAAWLERLKELP 196

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GSTO1NP_004823.1 GST_N_Omega 5..94 CDD:239353 24/74 (32%)