DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GSTO1 and GstE2

DIOPT Version :9

Sequence 1:NP_004823.1 Gene:GSTO1 / 9446 HGNCID:13312 Length:241 Species:Homo sapiens
Sequence 2:NP_611324.1 Gene:GstE2 / 37107 FlyBaseID:FBgn0063498 Length:221 Species:Drosophila melanogaster


Alignment Length:210 Identity:56/210 - (26%)
Similarity:97/210 - (46%) Gaps:30/210 - (14%)


- Green bases have known domain annotations that are detailed below.


Human    26 IYSMRFCPFAERTRLVLKAKGIRHEVININL---KNKPEWFFKKNPFGLVPVLENSQGQLIYES- 86
            :|.|...|.....:|.|:|..:.:|...::|   .:..:.|.||||...||:||:: |.||::| 
  Fly     7 LYGMDISPPVRACKLTLRALNLDYEYKEMDLLAGDHFKDAFLKKNPQHTVPLLEDN-GALIWDSH 70

Human    87 AITCEYLDEAYPGKKLLPDDPYEKA--CQKMILE---LFSKVPSL-VGSFIRSQN---KEDYAGL 142
            ||.|..:|:.....:|.|.|...:|  .|::..:   ||..:.:: :..|:|..:   ||....:
  Fly    71 AIVCYLVDKYANSDELYPRDLVLRAQVDQRLFFDASILFMSLRNVSIPYFLRQVSLVPKEKVDNI 135

Human   143 KEEF--RKEFTKLEEVLTNKKTTF----FGGNSISM-----IDYLIWP----WFERLEAMKLNEC 192
            |:.:  .:.|......||..:.|.    .|..:.|:     :|.|.:|    |||||..:...| 
  Fly   136 KDAYGHLENFLGDNPYLTGSQLTIADLCCGATASSLAAVLDLDELKYPKVAAWFERLSKLPHYE- 199

Human   193 VDHTPKLKLWMAAMK 207
            .|:...||.::..:|
  Fly   200 EDNLRGLKKYINLLK 214

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GSTO1NP_004823.1 GST_N_Omega 5..94 CDD:239353 24/71 (34%)