DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GSTO1 and GstE1

DIOPT Version :9

Sequence 1:NP_004823.1 Gene:GSTO1 / 9446 HGNCID:13312 Length:241 Species:Homo sapiens
Sequence 2:NP_611323.1 Gene:GstE1 / 37106 FlyBaseID:FBgn0034335 Length:224 Species:Drosophila melanogaster


Alignment Length:208 Identity:50/208 - (24%)
Similarity:90/208 - (43%) Gaps:37/208 - (17%)


- Green bases have known domain annotations that are detailed below.


Human    24 IRIYSMRFCPFAERTRLVLKAKGIRHEVININL---KNKPEWFFKKNPFGLVPVLENSQGQLIYE 85
            |.:|.....|.....:|.||...:.:|...:||   ::..|.:.||||...||:|::: |..|::
  Fly     6 IVLYGTDLSPCVRTVKLTLKVLNLDYEYKEVNLQAGEHLSEEYVKKNPQHTVPMLDDN-GTFIWD 69

Human    86 SAITCEYLDEAY-PGKKLLPDDPYEKAC--QKMILE---LFSKVPSLVGSFIRS------QNKED 138
            |.....||.:.| ...:|.|.|..::|.  |::..:   :::.:.::...|..:      |.|.|
  Fly    70 SHAIAAYLVDKYAKSDELYPKDLAKRAIVNQRLFFDASVIYASIANVSRPFWINGVTEVPQEKLD 134

Human   139 --YAGLKEEFRKEFTKLEEVLTNKKTTFFGGNSISMIDYLIWPWFERLEAMKLNECVD----HTP 197
              :.|||        .||..|.|  :.:..|:|:::.|....|....:.|     .||    ..|
  Fly   135 AVHQGLK--------LLETFLGN--SPYLAGDSLTLADLSTGPTVSAVPA-----AVDIDPATYP 184

Human   198 KLKLWMAAMKEDP 210
            |:..|:..:.:.|
  Fly   185 KVTAWLDRLNKLP 197

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GSTO1NP_004823.1 GST_N_Omega 5..94 CDD:239353 21/72 (29%)