DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GSTO1 and GstE13

DIOPT Version :9

Sequence 1:NP_004823.1 Gene:GSTO1 / 9446 HGNCID:13312 Length:241 Species:Homo sapiens
Sequence 2:NP_001188889.1 Gene:GstE13 / 35928 FlyBaseID:FBgn0033381 Length:226 Species:Drosophila melanogaster


Alignment Length:198 Identity:57/198 - (28%)
Similarity:82/198 - (41%) Gaps:28/198 - (14%)


- Green bases have known domain annotations that are detailed below.


Human    26 IYSMRFCPFAERTRLVLKAKGIRHEVININLKNK---PEWFFKKNPFGLVPVLENSQGQLIYES- 86
            :|...|.|.|....||.|..|:..|:..::...|   .|.|.|.||...:||..:|.|::..:| 
  Fly     6 LYYALFSPPARACILVAKLIGLDLELKPVDFAKKEHLSEEFVKLNPQHQIPVFVDSDGEVYVDSH 70

Human    87 AITCEYLDEAYPGK-KLLPDDPYEKA--CQKMILE---LFSKVPSLVGSFIRSQNKEDYAGLKEE 145
            ||.| :|...|.|. :|.|.|...:|  ..:|..|   ||..|..:|...|       |.|..|.
  Fly    71 AIVC-FLVA
KYAGNDQLYPRDLKRRAHIDHRMHYENGVLFQVVKDIVARNI-------YGGEGEY 127

Human   146 FRKEFT-------KLEEVLTNKKTTFFGGNSISMIDYLIWPWFERLEAMKLNECVDHTPKLKLWM 203
            ..:..|       .||..|  ::.:|..||.:|:.|..|......|:.:...| .:..|:.|.||
  Fly   128 NPRSLTLCHNAYSDLEHFL--QQGSFVVGNELSVADVSIHTTLVTLDLLIPVE-REKYPQTKQWM 189

Human   204 AAM 206
            ..|
  Fly   190 ERM 192

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GSTO1NP_004823.1 GST_N_Omega 5..94 CDD:239353 23/71 (32%)