DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MED26 and TfIIS

DIOPT Version :9

Sequence 1:NP_004822.2 Gene:MED26 / 9441 HGNCID:2376 Length:600 Species:Homo sapiens
Sequence 2:NP_001260457.1 Gene:TfIIS / 34883 FlyBaseID:FBgn0010422 Length:313 Species:Drosophila melanogaster


Alignment Length:233 Identity:48/233 - (20%)
Similarity:93/233 - (39%) Gaps:71/233 - (30%)


- Green bases have known domain annotations that are detailed below.


Human    32 LEVISSLEKYPITKEALEETRLGKLINDVRKKTKNEELAKRAKKLLRSWQK-LIEPAHQHEAALR 95
            |:::.:|:...|..:.|.:||:|..:|::||.:|::|:...||.|:::|:: |..||   .....
  Fly    28 LDLLKALQTLNINLDILTKTRIGMTVNELRKSSKDDEVIALAKTLIKNWKRFLASPA---PTTPN 89

Human    96 GLAGATGSANGGAHNCRPEVGAAGPPRSIHDLKSRNDLQRLPGQRLDRLGSRKRRGDQRDLGHPG 160
            ..:...||:|..:.:           :|....||.:.:.   |:  |:..|.....|:...|   
  Fly    90 NSSAKEGSSNNSSAS-----------KSTSAAKSSSSIS---GK--DKSSSSSSSKDKEKKG--- 135

Human   161 PPPKVSKASHDPLVPNSSPLPTNGIS------------------------GSPESFASSLDGSGH 201
                 |.:|      :.:..|:.|::                        |.||..|:.|:.:.:
  Fly   136 -----STSS------SQTSFPSGGMTDAVRIKCREMLATALKIGEVPEGCGEPEEMAAELEDAIY 189

Human   202 AGPEGSRLERDEND-KHSGKI---PVNAVRPHTSSPGL 235
            :       |.:..| |:..:|   ..|...|  .:|||
  Fly   190 S-------EFNNTDMKYKNRIRSRVANLKDP--KNPGL 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MED26NP_004822.2 TFS2N 12..86 CDD:197766 17/54 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 99..330 29/165 (18%)
Med26_M 177..417 CDD:292322 16/87 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 348..402
Med26_C 419..598 CDD:292321
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 431..461
TfIISNP_001260457.1 TFSII 5..313 CDD:273592 48/233 (21%)
TFS2N 7..82 CDD:197766 17/53 (32%)
TFIIS_M 151..257 CDD:284835 14/77 (18%)
Zn-ribbon_TFIIS 266..312 CDD:259796
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1594
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.