powered by:
Protein Alignment CDYL and HP6
DIOPT Version :9
Sequence 1: | NP_001355054.1 |
Gene: | CDYL / 9425 |
HGNCID: | 1811 |
Length: | 598 |
Species: | Homo sapiens |
Sequence 2: | NP_608842.1 |
Gene: | HP6 / 33661 |
FlyBaseID: | FBgn0031613 |
Length: | 106 |
Species: | Drosophila melanogaster |
Alignment Length: | 77 |
Identity: | 23/77 - (29%) |
Similarity: | 34/77 - (44%) |
Gaps: | 9/77 - (11%) |
- Green bases have known domain annotations that are detailed below.
Human 72 NKKGKTEYLVRWKGYDSEDDTWEPEQHLVNCEEYIHDFNRRH---TEKQKESTLTRTN--RTSPN 131
|..||..:|::|||.| |......|...|.|.:.:..|.... |::..|..|...| .|:|:
Fly 34 NWSGKLTFLMQWKGCD-EAGLVPAEVLNVRCPQMVISFYEERIVFTDEGDEEDLESDNGYETTPS 97
Human 132 NARKQISRSTNS 143
..:| ||.|:
Fly 98 PRKK---RSRNA 106
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG1911 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.810 |
|
Return to query results.
Submit another query.