DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CDYL and HP1b

DIOPT Version :9

Sequence 1:NP_001355054.1 Gene:CDYL / 9425 HGNCID:1811 Length:598 Species:Homo sapiens
Sequence 2:NP_001162713.1 Gene:HP1b / 31834 FlyBaseID:FBgn0030082 Length:240 Species:Drosophila melanogaster


Alignment Length:232 Identity:51/232 - (21%)
Similarity:89/232 - (38%) Gaps:63/232 - (27%)


- Green bases have known domain annotations that are detailed below.


Human    63 VERIVDKRKNKKGKTEYLVRWKGYDSEDDTWEPEQHLVNCEEYIHDFNRRHTEKQKESTLTRTNR 127
            |||:.||| ...|:|||.::||||...::||||.::| :|.:.|.:|.......:||:....:..
  Fly     6 VERVEDKR-TVNGRTEYYLKWKGYPRSENTWEPVENL-DCPDLIANFEESLKNNKKETKKRLSTS 68

Human   128 TSPNNARKQISRSTNSNF--SKTSPKALVIGKDHESKNSQLFAASQ------------------- 171
            ::|.:.     ||...:|  ..|..:..:||.:...:.|::..|:.                   
  Fly    69 STPESI-----RSKRKSFLEDDTEEQKKLIGFERGLEASKILGATDSSGHLMFLMKWKGSDHADL 128

Human   172 ---KFRKNTAPSL-------------------SSRKNMDLAKSGIKILVPKSPVKSRTA------ 208
               |......|.:                   .:..:::|..||....|..|.....||      
  Fly   129 VPAKLANTRCPQVVIQFYEERLTWHTGSGNGNGNTNSVNLGSSGGLGSVGGSGAGDDTAPGSVGT 193

Human   209 ------VDGFQSESPEKLDPVEQ-GQEDTVAPEVAAE 238
                  :||...|.||...|:.. .|::.:.|:.::|
  Fly   194 TGGGSNIDGGDEEDPEPASPIGSINQDENIKPDESSE 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CDYLNP_001355054.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..76 6/12 (50%)
Interaction with EZH2. /evidence=ECO:0000269|PubMed:22009739 61..309 51/232 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 112..149 6/38 (16%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 204..226 8/34 (24%)
Acetyl-CoA-binding domain. /evidence=ECO:0000255 362..594
HP1bNP_001162713.1 CHROMO 3..52 CDD:214605 22/47 (47%)
Chromo_shadow 100..151 CDD:279701 4/50 (8%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1911
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.