| Sequence 1: | NP_004814.1 | Gene: | KCNK6 / 9424 | HGNCID: | 6281 | Length: | 313 | Species: | Homo sapiens |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001097646.1 | Gene: | Shal / 40129 | FlyBaseID: | FBgn0005564 | Length: | 571 | Species: | Drosophila melanogaster |
| Alignment Length: | 53 | Identity: | 19/53 - (35%) |
|---|---|---|---|
| Similarity: | 26/53 - (49%) | Gaps: | 5/53 - (9%) |
- Green bases have known domain annotations that are detailed below.
|
Human 79 NASGSANASDPAWDFASALFFASTLITTVGYGYTTPLTDAGKAFSIAFALLGV 131 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| KCNK6 | NP_004814.1 | Ion_trans_2 | 75..146 | CDD:462301 | 19/53 (36%) |
| Selectivity filter 1. /evidence=ECO:0000250|UniProtKB:P57789 | 106..111 | 3/4 (75%) | |||
| Ion_trans_2 | 180..256 | CDD:462301 | |||
| Selectivity filter 2. /evidence=ECO:0000250|UniProtKB:P57789 | 214..219 | ||||
| Lysosomal targeting signal. /evidence=ECO:0000250|UniProtKB:G3V8R8 | 282..290 | ||||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 288..313 | ||||
| Lysosomal targeting signal. /evidence=ECO:0000250|UniProtKB:G3V8R8 | 308..312 | ||||
| Shal | NP_001097646.1 | BTB_POZ_Shal-like | 6..144 | CDD:349727 | |
| Ion_trans | 188..415 | CDD:459842 | 19/53 (36%) | ||
| DUF3399 | 471..535 | CDD:463381 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||