DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NTN1 and LanA

DIOPT Version :9

Sequence 1:NP_004813.2 Gene:NTN1 / 9423 HGNCID:8029 Length:604 Species:Homo sapiens
Sequence 2:NP_476617.1 Gene:LanA / 38723 FlyBaseID:FBgn0002526 Length:3712 Species:Drosophila melanogaster


Alignment Length:488 Identity:146/488 - (29%)
Similarity:226/488 - (46%) Gaps:79/488 - (16%)


- Green bases have known domain annotations that are detailed below.


Human    53 PDFVNAAFGKDVRVSSTCGRP---PARYCVVSERGEE---------RLRSCHLCNASDPKKAHPP 105
            |.:.|.|.|:.:..::|||:.   |..||.:.....|         :.:.|..|:.:.|::.|||
  Fly    26 PPYFNLATGRKIYATATCGQDTDGPELYCKLVGANTEHDHIDYSVIQGQVCDYCDPTVPERNHPP 90

Human   106 AFLTDLNNPHNLTCWQS---ENYLQFPHNVTLTLSLGKKFEVTYVSLQF-CSPRPESMAIYKSMD 166
            ....|...    ..|||   ...::| :.|.||::..::|.|.|:.::. .||||....:.||.|
  Fly    91 ENAIDGTE----AWWQSPPLSRGMKF-NEVNLTINFEQEFHVAYLFIRMGNSPRPGLWTLEKSTD 150

Human   167 YGRTWVPFQFYS---TQCRKMYNRPHRAPITKQNEQEAVCTDSHTDMRPLSGGLIAFSTLDGRPS 228
            ||:||.|:|.:|   ..|...:.:....|||:  :.:.:||..::.:.||..|.|....|:.|||
  Fly   151 YGKTWTPWQHFSDTPADCETYFGKDTYKPITR--DDDVICTTEYSKIVPLENGEIPVMLLNERPS 213

Human   229 AHDFDNSPVLQDWVTATDIRVAFSRL-----HTFGDENEDDSELARDSYFYAVSDLQVGGRCKCN 288
            :.::.||.|||:|..||::|:...|.     |......:|.:...|  |||::.|:.:||||.||
  Fly   214 STNYFNSTVLQEWTRATNVRIRLLRTKNLLGHLMSVARQDPTVTRR--YFYSIKDISIGG
RCMCN 276

Human   289 GHAARC-VRDRDDS---LVCDCRHNTAGPECDRCKPFHYDRPWQRATAREANECVACNCNLHARR 349
            |||..| |:|....   |.|.|:|:|.|.:|:.|.|....:.|::.|......|..|||:.|:..
  Fly   277 GHADTCDVKDPKSPVRILACRCQHHTCGIQCNECCPGF
EQKKWRQNTNARPFNCEPCNCHGHSNE 341

Human   350 CRFNMELYK------LSGR-KSGGVCLNCRHNTAGRHCHYCKEGYYRDMGKPITHRKACKACDCH 407
            |:::.|:.:      :.|. ..||||.||:|||.|.:|:.||..|||..||.......|..|.|.
  Fly   342 CKYDEEVNRKGLSLDIHGHYDGGGVCQNCQHNTVGINCNKCKPKYYRP
KGKHWNETDVCSPCQCD 406

Human   408 PVGAAGKTCNQTTGQCPCKDGVTGITCNRCAKGYQQSRSPIAPCIKIPVAPPTTAASSVEEPEDC 472
            ...:.|. |.:.||.|.|:......:|:.||.||.                      ......:|
  Fly   407 YFFSTGH-CEEETGNCECRAAFQPPSCDSCAYGYY----------------------GYPNCREC 448

Human   473 DS--------YCKASKGK---LKINMK-KYCKK 493
            :.        :|:|..|:   .|||.. .|||:
  Fly   449 ECNLNGTNGYHCEAESGQQCPCKINFAGAYCKQ 481

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NTN1NP_004813.2 LamNT 46..283 CDD:214532 73/253 (29%)
EGF_Lam 284..329 CDD:238012 20/48 (42%)
Laminin_EGF 341..401 CDD:395007 25/66 (38%)
Laminin_EGF 404..>441 CDD:395007 11/36 (31%)
NTR_netrin-1_like 487..601 CDD:239634 3/8 (38%)
Cell attachment site. /evidence=ECO:0000255 530..532
LanANP_476617.1 LamNT 18..271 CDD:214532 73/253 (29%)
EGF_Lam 272..>314 CDD:238012 19/41 (46%)
EGF_Lam 332..389 CDD:238012 22/56 (39%)
EGF_Lam 402..443 CDD:238012 13/63 (21%)
EGF_Lam 448..491 CDD:238012 10/34 (29%)
Laminin_EGF 495..543 CDD:278482
Laminin_EGF 541..589 CDD:278482
Laminin_EGF 587..634 CDD:278482
EGF_Lam 631..673 CDD:238012
Laminin_EGF 677..729 CDD:278482
Laminin_EGF 732..782 CDD:278482
EGF_Lam 785..828 CDD:238012
CBM6-CBM35-CBM36_like 831..966 CDD:271143
Laminin_EGF 1375..1423 CDD:278482
EGF_Lam 1420..1457 CDD:238012
Laminin_EGF 1466..1516 CDD:278482
Laminin_EGF 1514..1562 CDD:278482
LamB 1632..1760 CDD:214597
Laminin_EGF <1775..1801 CDD:278482
EGF_Lam 1808..1851 CDD:238012
EGF_Lam 1859..1907 CDD:214543
EGF_Lam 1916..1968 CDD:238012
EGF_Lam 1969..2015 CDD:238012
EGF_Lam 2016..>2054 CDD:238012
EGF_Lam 2063..>2097 CDD:238012
Laminin_I 2129..2385 CDD:283627
Tar 2278..2662 CDD:223910
Laminin_II 2566..2700 CDD:283628
LamG 2674..2843 CDD:238058
LamG 2878..3029 CDD:238058
LamG 3078..3205 CDD:214598
LamG 3349..3512 CDD:238058
LamG 3535..3689 CDD:238058
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.