DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HAND1 and CG33557

DIOPT Version :9

Sequence 1:NP_004812.1 Gene:HAND1 / 9421 HGNCID:4807 Length:215 Species:Homo sapiens
Sequence 2:NP_001014730.1 Gene:CG33557 / 3346145 FlyBaseID:FBgn0053557 Length:150 Species:Drosophila melanogaster


Alignment Length:114 Identity:44/114 - (38%)
Similarity:63/114 - (55%) Gaps:11/114 - (9%)


- Green bases have known domain annotations that are detailed below.


Human    42 FQSWLLSPADAAPDFPAGGPPPAAAAAATAYGPDARPGQ--SPGRLEALGGRLGRRKGSGPK--- 101
            |.::|:  |..|.|..:.|  .|:.:.|.|...|::.||  :||..|..|..  ||:....|   
  Fly    10 FSNYLM--AVFAQDSNSSG--SASGSGAAADSEDSQIGQEANPGGQENQGNH--RRRPPRQKINA 68

Human   102 KERRRTESINSAFAELRECIPNVPADTKLSKIKTLRLATSYIAYLMDVL 150
            :||.||.::|||:..||..||..|.:.|||||:.:|||:|||.:|...|
  Fly    69 RERYRTFNVNSAYEALRNLIPTEPMNRKLSKIEIIRLASSYITHLSSTL 117

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HAND1NP_004812.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 53..109 20/60 (33%)
bHLH_TS_HAND1 94..153 CDD:381522 28/60 (47%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 166..198
CG33557NP_001014730.1 HLH 67..119 CDD:197674 25/51 (49%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165149587
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.