DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Idh3b and CG32026

DIOPT Version :9

Sequence 1:NP_446033.1 Gene:Idh3b / 94173 RGDID:621881 Length:385 Species:Rattus norvegicus
Sequence 2:NP_729420.1 Gene:CG32026 / 317829 FlyBaseID:FBgn0052026 Length:719 Species:Drosophila melanogaster


Alignment Length:340 Identity:132/340 - (38%)
Similarity:211/340 - (62%) Gaps:16/340 - (4%)


- Green bases have known domain annotations that are detailed below.


  Rat    51 VTMLPGDGVGPELMHAVKEVFKAAAVPVEFKEHHLSEVQNMASEEKL-EQVLSSMKENKVAIIGK 114
            :|::||||:|||:..||.::.:||..|:.|:...::.|.|......: |||:.||...||.:.|.
  Fly   385 ITLMPGDGIGPEISMAVIKILEAAKTPLIFEPVDVTPVLNSQGMTSVPEQVIESMNRTKVGLKGP 449

  Rat   115 IYTPMEYKGE-LASYDMQLRRKLDLFANVVHVKSLPGYKTRHNNLDLVIIREQTEGEYSSLEHES 178
            :.||:   |. ..|.::.||:..:|:||:...:||||.:|.:.::|:|.|||.||||||.:||..
  Fly   450 LMTPV---GTGFRSLNLTLRQLFNLYANIRPCRSLPGVETVYGDVDIVTIRENTEGEYSGIEHTL 511

  Rat   179 ARGVIECLKIVTRTKSQRIAKFAFDYATKKGRSKVTAVHKANIMKLGDGLFLQCCEEVAELYPK- 242
            ..||::.:|::||..|.|:|::.|.||....|.|||||.::.:|::.|||||:|..|:|..|.. 
  Fly   512 VNGVVQSIKLITRNASLRVAEYTFQYALAMKRKKVTAVAESQVMRMSDGLFLRCVREMAAKYKSK 576

  Rat   243 -----IKFETMIIDNCCMQLVQNPYQFDVLVMPNLYGNIIDNLAAGLVGGAGVVPGESYSAEYAV 302
                 ||:|...:...|:.:||:|.::|:||:|||||:||.:..|||:||.|:.|..:.....|:
  Fly   577 MDQAGIKYEESTMTTVCLNIVQDPKRYDMLVLPNLYGDIISDTCAGLIGGLGLTPSGNVGTNGAI 641

  Rat   303 FET--GARHPFAQAVGRNIANPTAMLLSASNMLRHLNLEYHSSMIADAVKKVIKVGKVRTRDMGG 365
            ||:  |.....|   |:::|||||:|||:..||.::.|..|:..|..||.|.|:...:||.|:||
  Fly   642 FESVHGTAPDIA---GKDLANPTALLLSSVMMLHYIGLHEHADKIEKAVLKTIRDDNIRTMDLGG 703

  Rat   366 YSTTTDFIKSVIGHL 380
            .:..:::..::|.:|
  Fly   704 KAKCSEYTDALIKNL 718

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Idh3bNP_446033.1 Iso_dh 47..380 CDD:294303 131/338 (39%)
CG32026NP_729420.1 FGF-BP1 <281..361 CDD:284004
Iso_dh 382..718 CDD:294303 131/338 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0473
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D325037at33208
OrthoFinder 1 1.000 - - FOG0000244
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.