DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ORMDL1 and Ormdl1

DIOPT Version :9

Sequence 1:NP_001358314.1 Gene:ORMDL1 / 94101 HGNCID:16036 Length:158 Species:Homo sapiens
Sequence 2:NP_663492.3 Gene:Ormdl1 / 227102 MGIID:2181669 Length:153 Species:Mus musculus


Alignment Length:152 Identity:150/152 - (98%)
Similarity:151/152 - (99%) Gaps:0/152 - (0%)


- Green bases have known domain annotations that are detailed below.


Human     1 MNVGVAHSEVNPNTRVMNSRGMWLTYALGVGLLHIVLLSIPFFSVPVAWTLTNIIHNLGMYVFLH 65
            ||||||||||||||||||||||||||||||||||||||||||.||||||||||||||||||||||
Mouse     1 MNVGVAHSEVNPNTRVMNSRGMWLTYALGVGLLHIVLLSIPFCSVPVAWTLTNIIHNLGMYVFLH 65

Human    66 AVKGTPFETPDQGKARLLTHWEQLDYGVQFTSSRKFFTISPIILYFLASFYTKYDPTHFILNTAS 130
            |||||||||||||:|||||||||||||||||||||||||||||||||||||||||||||||||||
Mouse    66 AVKGTPFETPDQGRARLLTHWEQLDYGVQFTSSRKFFTISPIILYFLASFYTKYDPTHFILNTAS 130

Human   131 LLSVLIPKMPQLHGVRIFGINK 152
            ||||||||||||||||||||||
Mouse   131 LLSVLIPKMPQLHGVRIFGINK 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ORMDL1NP_001358314.1 ORMDL 11..146 CDD:367791 132/134 (99%)
Ormdl1NP_663492.3 ORMDL 11..146 CDD:367791 132/134 (99%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 278 1.000 Domainoid score I17716
eggNOG 1 0.900 - - E1_COG5081
HGNC 1 1.500 - -
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H41135
Inparanoid 1 1.050 312 1.000 Inparanoid score I14947
Isobase 00.000 Not matched by this tool.
NCBI 1 1.000 - -
OMA 1 1.010 - - QHG54404
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001304
OrthoInspector 1 1.000 - - oto112727
orthoMCL 1 0.900 - - OOG6_102694
Panther 1 1.100 - - LDO PTHR12665
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1721
SonicParanoid 1 1.000 - - X1334
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1616.360

Return to query results.
Submit another query.