DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CD80 and si:dkey-22i16.9

DIOPT Version :9

Sequence 1:NP_005182.1 Gene:CD80 / 941 HGNCID:1700 Length:288 Species:Homo sapiens
Sequence 2:XP_003197745.2 Gene:si:dkey-22i16.9 / 100536567 ZFINID:ZDB-GENE-090313-261 Length:448 Species:Danio rerio


Alignment Length:200 Identity:43/200 - (21%)
Similarity:78/200 - (39%) Gaps:31/200 - (15%)


- Green bases have known domain annotations that are detailed below.


Human    28 LSHFCSGVIHVTKEVKEVATLSCGHNVSVEELAQT-RIYWQKEKKMVLTMMSGDMNIWPEYKNRT 91
            |..|....|:.|  |:..|.|.|......:...:| .|.|:|:.::||.:::|.:...|.:.:|.
Zfish   123 LEAFVPTTINTT--VRGKAKLPCYARTEKQISDETVNILWKKDDQVVLQVLNGIIKYGPRFTDRA 185

Human    92 IFDITN----NLSIVILALRPSDEGTYECVVLKYEKDAFKREHLAEVTLSVKA------------ 140
            ...:.:    .||:.|.....||.|.|:|    |.|.:.:..|...|||.|.|            
Zfish   186 SVSLKDYKDGELSLTIHNASRSDAGLYQC----YHKPSEEHGHPGAVTLHVAALEISWTKKFGEN 246

Human   141 ---DFPTPSISDFEIPTSNIRRIICSTSGGFPEPHLSWLENGEELNAINTTVSQ---DPETELYA 199
               |..:..::...|.:....:.:|:..|...:....::.....:|  ||.|..   ..:..::.
Zfish   247 LPLDLFSSDVTISFIGSDESEKQVCTVMGNSTKCSSDYINRVSVIN--NTLVLSGLTSADKGIFT 309

Human   200 VSSKL 204
            |..|:
Zfish   310 VKDKI 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CD80NP_005182.1 IgV_CD80 35..139 CDD:319335 29/108 (27%)
IgC_CD80 142..232 CDD:319332 9/65 (14%)
si:dkey-22i16.9XP_003197745.2 IG_like 30..>110 CDD:214653
IG_like 128..232 CDD:214653 29/109 (27%)
Ig 137..214 CDD:299845 19/76 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
NCBI 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1083437at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.