Sequence 1: | NP_005182.1 | Gene: | CD80 / 941 | HGNCID: | 1700 | Length: | 288 | Species: | Homo sapiens |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_003197745.2 | Gene: | si:dkey-22i16.9 / 100536567 | ZFINID: | ZDB-GENE-090313-261 | Length: | 448 | Species: | Danio rerio |
Alignment Length: | 200 | Identity: | 43/200 - (21%) |
---|---|---|---|
Similarity: | 78/200 - (39%) | Gaps: | 31/200 - (15%) |
- Green bases have known domain annotations that are detailed below.
Human 28 LSHFCSGVIHVTKEVKEVATLSCGHNVSVEELAQT-RIYWQKEKKMVLTMMSGDMNIWPEYKNRT 91
Human 92 IFDITN----NLSIVILALRPSDEGTYECVVLKYEKDAFKREHLAEVTLSVKA------------ 140
Human 141 ---DFPTPSISDFEIPTSNIRRIICSTSGGFPEPHLSWLENGEELNAINTTVSQ---DPETELYA 199
Human 200 VSSKL 204 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CD80 | NP_005182.1 | IgV_CD80 | 35..139 | CDD:319335 | 29/108 (27%) |
IgC_CD80 | 142..232 | CDD:319332 | 9/65 (14%) | ||
si:dkey-22i16.9 | XP_003197745.2 | IG_like | 30..>110 | CDD:214653 | |
IG_like | 128..232 | CDD:214653 | 29/109 (27%) | ||
Ig | 137..214 | CDD:299845 | 19/76 (25%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
NCBI | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1083437at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.920 |