DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ZRANB2 and Zranb2

DIOPT Version :9

Sequence 1:NP_976225.1 Gene:ZRANB2 / 9406 HGNCID:13058 Length:330 Species:Homo sapiens
Sequence 2:NP_059077.1 Gene:Zranb2 / 53861 MGIID:1858211 Length:330 Species:Mus musculus


Alignment Length:330 Identity:320/330 - (96%)
Similarity:322/330 - (97%) Gaps:0/330 - (0%)


- Green bases have known domain annotations that are detailed below.


Human     1 MSTKNFRVSDGDWICPDKKCGNVNFARRTSCNRCGREKTTEAKMMKAGGTEIGKTLAEKSRGLFS 65
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Mouse     1 MSTKNFRVSDGDWICPDKKCGNVNFARRTSCNRCGREKTTEAKMMKAGGTEIGKTLAEKSRGLFS 65

Human    66 ANDWQCKTCSNVNWARRSECNMCNTPKYAKLEERTGYGGGFNERENVEYIEREESDGEYDEFGRK 130
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Mouse    66 ANDWQCKTCSNVNWARRSECNMCNTPKYAKLEERTGYGGGFNERENVEYIEREESDGEYDEFGRK 130

Human   131 KKKYRGKAVGPASILKEVEDKESEGEEEDEDEDLSKYKLDEDEDEDDADLSKYNLDASEEEDSNK 195
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Mouse   131 KKKYRGKAVGPASILKEVEDKESEGEEEDEDEDLSKYKLDEDEDEDDADLSKYNLDASEEEDSNK 195

Human   196 KKSNRRSRSKSRSSHSRSSSRSSSPSSSRSRSRSRSRSSSSSQSRSRSSSRERSRSRGSKSRSSS 260
            ||||||||||||||||||||||||||||||||||||||||||||||.|.|||.||||||||||||
Mouse   196 KKSNRRSRSKSRSSHSRSSSRSSSPSSSRSRSRSRSRSSSSSQSRSHSGSREHSRSRGSKSRSSS 260

Human   261 RSHRGSSSPRKRSYSSSSSSPERNRKRSRSRSSSSGDRKKRRTRSRSPERRHRSSSGSSHSGSRS 325
            |||||||||||||||||||||||:|||||||.||...|||||||||||||.|||||||:||||||
Mouse   261 RSHRGSSSPRKRSYSSSSSSPERDRKRSRSRPSSPAVRKKRRTRSRSPERHHRSSSGSTHSGSRS 325

Human   326 SSKKK 330
            |||||
Mouse   326 SSKKK 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZRANB2NP_976225.1 ZnF_RBZ 11..35 CDD:197784 23/23 (100%)
RanBP2-type Zn finger 13..34 CDD:275376 20/20 (100%)
ZnF_RBZ 67..91 CDD:197784 23/23 (100%)
RanBP2-type Zn finger 69..88 CDD:275376 18/18 (100%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 117..330 202/212 (95%)
Required for nuclear targeting 151..324 162/172 (94%)
Zranb2NP_059077.1 ZnF_RBZ 11..35 CDD:197784 23/23 (100%)
RanBP2-type Zn finger 13..34 CDD:275376 20/20 (100%)
ZnF_RBZ 67..91 CDD:197784 23/23 (100%)
RanBP2-type Zn finger 69..88 CDD:275376 18/18 (100%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 117..330 202/212 (95%)
Required for nuclear targeting. /evidence=ECO:0000250 151..324 162/172 (94%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C83952576
Domainoid 1 1.000 435 1.000 Domainoid score I10080
eggNOG 1 0.900 - - E1_KOG1995
HGNC 1 1.500 - -
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 637 1.000 Inparanoid score I10093
Isobase 1 0.950 - 0 Normalized mean entropy S3106
NCBI 1 1.000 - -
OMA 1 1.010 - - QHG60166
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007371
OrthoInspector 1 1.000 - - oto120144
orthoMCL 1 0.900 - - OOG6_106338
Panther 1 1.100 - - LDO PTHR12999
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3341
SonicParanoid 1 1.000 - - X5493
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1818.240

Return to query results.
Submit another query.