DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ZRANB2 and CG3732

DIOPT Version :9

Sequence 1:NP_976225.1 Gene:ZRANB2 / 9406 HGNCID:13058 Length:330 Species:Homo sapiens
Sequence 2:NP_611692.1 Gene:CG3732 / 37588 FlyBaseID:FBgn0034750 Length:282 Species:Drosophila melanogaster


Alignment Length:277 Identity:127/277 - (45%)
Similarity:162/277 - (58%) Gaps:52/277 - (18%)


- Green bases have known domain annotations that are detailed below.


Human     9 SDGDWICPDKKCGNVNFARRTSCNRCGREK------------------------TTEAKMMKAGG 49
            |.|||||||..|.::|||||..||:|.|::                        ::.:...|..|
  Fly    20 SPGDWICPDYDCRHLNFARRLQCNKCDRDRDGSDKPERDRDRDRERERGNGSSSSSSSSSKKKLG 84

Human    50 TEIGKTLAEKSRGLFSANDWQCKTCSNVNWARRSECNMCNTPKYAKLEERTGYGGGFNERENVEY 114
            |||||..|:||||||||.||||..|:|||||||..|||||.||::.:|||||:|||:|:|..|||
  Fly    85 TEIGKAAADKSRGLFSAEDWQCSKCANVNWARRQTCNMCNAPKFSDVEERTGFGGGYNDRGVVEY 149

Human   115 IEREESDGEYDEFGRKKKKYRGKAVGPASILKEVED-----KESEGEEEDEDEDLSKYKLDEDED 174
            .:|::||.|||||||:||:..|         :..||     :.|..|:.:::|:      |||:|
  Fly   150 KDRQDSDSEYDEFGRRKKRKHG---------EHREDSKRPRRSSRDEQRNDEEE------DEDDD 199

Human   175 E-DDADLSKYNLDASEEEDSNKKKS-------NRRSRSKSRSSHSRSSSRSSSPSSSRSRSRSRS 231
            | ||.|||||:|...||..|...||       ::..:..||.|.|..||.|||.|||.|.|.|.|
  Fly   200 EGDDEDLSKYDLWGDEEVTSTDVKSKEGTGNGDKERKRTSRDSTSSVSSSSSSSSSSSSDSSSSS 264

Human   232 RSSSSSQSRSRSSSRER 248
            .|||||..|.::||..|
  Fly   265 SSSSSSGGRRKTSSSGR 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZRANB2NP_976225.1 ZnF_RBZ 11..35 CDD:197784 15/23 (65%)
RanBP2-type Zn finger 13..34 CDD:275376 13/20 (65%)
ZnF_RBZ 67..91 CDD:197784 17/23 (74%)
RanBP2-type Zn finger 69..88 CDD:275376 13/18 (72%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 117..330 61/145 (42%)
Required for nuclear targeting 151..324 46/106 (43%)
CG3732NP_611692.1 ZnF_RBZ 22..46 CDD:197784 15/23 (65%)
RanBP2-type Zn finger 24..45 CDD:275376 13/20 (65%)
zf-RanBP 100..129 CDD:279035 21/28 (75%)
RanBP2-type Zn finger 104..123 CDD:275376 13/18 (72%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165142145
Domainoid 1 1.000 113 1.000 Domainoid score I6169
eggNOG 1 0.900 - - E1_KOG1995
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 223 1.000 Inparanoid score I3538
Isobase 1 0.950 - 0 Normalized mean entropy S3106
OMA 1 1.010 - - QHG60166
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007371
OrthoInspector 1 1.000 - - oto88313
orthoMCL 1 0.900 - - OOG6_106338
Panther 1 1.100 - - LDO PTHR12999
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3341
SonicParanoid 1 1.000 - - X5493
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1514.740

Return to query results.
Submit another query.