DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment ZRANB2 and SPAC17H9.04c

DIOPT Version :9

Sequence 1:	NP_976225.1	Gene:	ZRANB2 / 9406	HGNCID:	13058	Length:	330	Species:	Homo sapiens
Sequence 2:	NP_593574.1	Gene:	SPAC17H9.04c / 2542253	PomBaseID:	SPAC17H9.04c	Length:	604	Species:	Schizosaccharomyces pombe

Alignment Length:	161	Identity:	37/161 - (22%)
Similarity:	46/161 - (28%)	Gaps:	62/161 - (38%)

- Green bases have known domain annotations that are detailed below.

Human     6 FRVSDGDWICPDKKCGNVNFARRTSCNRCGREKTTEAKM-------------------------- 44
            ||.  |||.|..:.||..|||:...|.|||..:.|.|.:
pombe   444 FRA--GDWKCGSEGCGYHNFAKNVCCLRCGASRATAAVVADHASGPVNGSYSHNSYSHIPPVMST 506

Human    45 -----------------------MKAGGTEIGKTLAEKSRGLF----------SANDWQCKTCSN 76
                                   ...||...|........|.|          ...||.|: |..
pombe   507 SPPNHSVYPYSQLSINSVTANHGQNFGGQNGGNVSRFDDHGRFKEVSRPSVTTDQGDWLCE-CGF 570

Human    77 VNWARRSECNMCNTPKYAKLEERTGYGGGFN 107
            .|:.|||.|..||.|.|:.::........||
pombe   571 TNFRRRSNCLRCNAPHYSNMQIPASLPSDFN 601

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
ZRANB2	NP_976225.1	ZnF_RBZ	11..35	CDD:197784	11/23 (48%)
		RanBP2-type Zn finger	13..34	CDD:275376	8/20 (40%)
		ZnF_RBZ	67..91	CDD:197784	11/23 (48%)
		RanBP2-type Zn finger	69..88	CDD:275376	8/18 (44%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	117..330
		Required for nuclear targeting	151..324
SPAC17H9.04c	NP_593574.1	RRM	<233..>317	CDD:223796
		RRM_ARP_like	244..326	CDD:240898
		zf-RanBP	343..371	CDD:279035
		RanBP2-type Zn finger	347..366	CDD:275375
		RanBP2-type Zn finger	391..424	CDD:275375
		zf-RanBP	445..474	CDD:279035	14/30 (47%)
		RanBP2-type Zn finger	449..470	CDD:275375	8/20 (40%)
		RanBP2-type Zn finger	512..540	CDD:275375	3/27 (11%)
		ZnF_RBZ	562..585	CDD:197784	11/23 (48%)
		RanBP2-type Zn finger	564..582	CDD:275375	8/18 (44%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.910