DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ZRANB2 and SPAC17H9.04c

DIOPT Version :9

Sequence 1:NP_976225.1 Gene:ZRANB2 / 9406 HGNCID:13058 Length:330 Species:Homo sapiens
Sequence 2:NP_593574.1 Gene:SPAC17H9.04c / 2542253 PomBaseID:SPAC17H9.04c Length:604 Species:Schizosaccharomyces pombe


Alignment Length:161 Identity:37/161 - (22%)
Similarity:46/161 - (28%) Gaps:62/161 - (38%)


- Green bases have known domain annotations that are detailed below.


Human     6 FRVSDGDWICPDKKCGNVNFARRTSCNRCGREKTTEAKM-------------------------- 44
            ||.  |||.|..:.||..|||:...|.|||..:.|.|.:                          
pombe   444 FRA--GDWKCGSEGCGYHNFAKNVCCLRCGASRATAAVVADHASGPVNGSYSHNSYSHIPPVMST 506

Human    45 -----------------------MKAGGTEIGKTLAEKSRGLF----------SANDWQCKTCSN 76
                                   ...||...|........|.|          ...||.|: |..
pombe   507 SPPNHSVYPYSQLSINSVTANHGQNFGGQNGGNVSRFDDHGRFKEVSRPSVTTDQGDWLCE-CGF 570

Human    77 VNWARRSECNMCNTPKYAKLEERTGYGGGFN 107
            .|:.|||.|..||.|.|:.::........||
pombe   571 TNFRRRSNCLRCNAPHYSNMQIPASLPSDFN 601

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZRANB2NP_976225.1 ZnF_RBZ 11..35 CDD:197784 11/23 (48%)
RanBP2-type Zn finger 13..34 CDD:275376 8/20 (40%)
ZnF_RBZ 67..91 CDD:197784 11/23 (48%)
RanBP2-type Zn finger 69..88 CDD:275376 8/18 (44%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 117..330
Required for nuclear targeting 151..324
SPAC17H9.04cNP_593574.1 RRM <233..>317 CDD:223796
RRM_ARP_like 244..326 CDD:240898
zf-RanBP 343..371 CDD:279035
RanBP2-type Zn finger 347..366 CDD:275375
RanBP2-type Zn finger 391..424 CDD:275375
zf-RanBP 445..474 CDD:279035 14/30 (47%)
RanBP2-type Zn finger 449..470 CDD:275375 8/20 (40%)
RanBP2-type Zn finger 512..540 CDD:275375 3/27 (11%)
ZnF_RBZ 562..585 CDD:197784 11/23 (48%)
RanBP2-type Zn finger 564..582 CDD:275375 8/18 (44%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.