DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LPXN and ey

DIOPT Version :9

Sequence 1:NP_001137467.1 Gene:LPXN / 9404 HGNCID:14061 Length:391 Species:Homo sapiens
Sequence 2:NP_001014693.1 Gene:ey / 43812 FlyBaseID:FBgn0005558 Length:898 Species:Drosophila melanogaster


Alignment Length:216 Identity:41/216 - (18%)
Similarity:61/216 - (28%) Gaps:76/216 - (35%)


- Green bases have known domain annotations that are detailed below.


Human    18 RSTLQDSDEYSNPAPLPLD-QHSRKETNLDETSEILSIQDNTSPLPAQLVYTTNIQELNVYSEAQ 81
            |.||..|.:....| .||: ..|...:|..|.||..:|.:             .::.||....| 
  Fly   265 RGTLSSSTDLMQTA-TPLNSSESGGASNSGEGSEQEAIYE-------------KLRLLNTQHAA- 314

Human    82 EPKESPPPSKTSAAAQLDELMAHLTEMQAKVAVRADAGKKHLPDKQDHKASLDSMLGGLEQELQD 146
                .|.|.:.:.||.|                 ......||..:..|...:......|:|..| 
  Fly   315 ----GPGPLEPARAAPL-----------------VGQSPNHLGTRSSHPQLVHGNHQALQQHQQ- 357

Human   147 LGIATVPKGHCASCQKPIAGKVIHALGQSWHPEHFVCTHCKEEIGSSPFFERSGLAYCPNDYHQL 211
                                       |||.|.|:..:.....:...|      ::..||     
  Fly   358 ---------------------------QSWPPRHYSGSWYPTSLSEIP------ISSAPN----- 384

Human   212 FSPRCAYCAAPILDKVLTAMN 232
            .:...||.:.|.|...|:..|
  Fly   385 IASVTAYASGPSLAHSLSPPN 405

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LPXNNP_001137467.1 LIM1_Leupaxin 155..209 CDD:188790 8/53 (15%)
LIM2_Leupaxin 216..267 CDD:188792 6/17 (35%)
LIM3_Leupaxin 275..327 CDD:188794
LIM4_Paxillin_like 334..385 CDD:188725
eyNP_001014693.1 PAX 98..221 CDD:128645
Homeobox 475..527 CDD:278475
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6207
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.