DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LPXN and CG30178

DIOPT Version :10

Sequence 1:NP_001137467.1 Gene:LPXN / 9404 HGNCID:14061 Length:391 Species:Homo sapiens
Sequence 2:NP_726395.1 Gene:CG30178 / 246501 FlyBaseID:FBgn0050178 Length:187 Species:Drosophila melanogaster


Alignment Length:169 Identity:54/169 - (31%)
Similarity:85/169 - (50%) Gaps:0/169 - (0%)


- Green bases have known domain annotations that are detailed below.


Human   216 CAYCAAPILDKVLTAMNQTWHPEHFFCSHCGEVFGAEGFHEKDKKPYCRKDFLAMFSPKCGGCNR 280
            |..|...|..:.:.::.:|:||.||.|..||.|...:.|...|....|.:.:|...:.:|..|..
  Fly     6 CCRCNEKIWPRAVCSLGKTYHPHHFTCKECGLVVDPKLFFAVDDDVVCSECYLDKHAARCSACRT 70

Human   281 PVLENYLSAMDTVWHPECFVCGDCFTSFSTGSFFELDGRPFCELHYHHRRGTLCHGCGQPITGRC 345
            |:||..::|.:..||.:||.|..|..|..:.||||::|..||:.|:.....:.|.||.:||..|.
  Fly    71 PILERGVAAAERKWHEKCFRCVSCSKSLVSASFFEVNGYLFCKAHFRELFSSRCAGCEKPIDRRA 135

Human   346 ISAMGYKFHPEHFVCAFCLTQLSKGIFREQNDKTYCQPC 384
            :.|:..|:|.:.|.|..|..::|...|..:|.:..|..|
  Fly   136 VVALSTKWHAKCFKCHHCRKRISAREFWIENGQPICAAC 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LPXNNP_001137467.1 LIM1_Leupaxin 155..209 CDD:188790
LIM2_Leupaxin 216..267 CDD:188792 15/50 (30%)
LIM3_Leupaxin 275..327 CDD:188794 21/51 (41%)
LIM4_Paxillin_like 334..385 CDD:188725 17/51 (33%)
CG30178NP_726395.1 LIM 6..61 CDD:413332 16/54 (30%)
LIM 65..116 CDD:259829 20/50 (40%)
LIM 124..171 CDD:413332 15/46 (33%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.