DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LRRC4B and kek3

DIOPT Version :9

Sequence 1:NP_001073926.1 Gene:LRRC4B / 94030 HGNCID:25042 Length:713 Species:Homo sapiens
Sequence 2:NP_001162986.1 Gene:kek3 / 34912 FlyBaseID:FBgn0028370 Length:1021 Species:Drosophila melanogaster


Alignment Length:750 Identity:186/750 - (24%)
Similarity:266/750 - (35%) Gaps:209/750 - (27%)


- Green bases have known domain annotations that are detailed below.


Human    13 PPGRMSWPHGALLFLWLFSPPLGAGGGGVAVTSAAGGGSPPATSCPVACSCSNQASR--VICTRR 75
            ||.|...|....|.|||           :...|..|   .....||..|.|..::.:  |:|...
  Fly    49 PPLRPRLPLHLHLLLWL-----------LCCCSQLG---QLRAECPAVCECKWKSGKESVLCLNA 99

Human    76 DLAEVPASIPVNTRYLNLQENGIQVIRTDTF--KHLRHLEILQLSKNLVRKIEVGAFNGLPSLNT 138
            :|..:|..:...|:.|:|..|.||:|..|:|  ..|.:|:.:.|::..:|.||..||..|.:|..
  Fly   100 NLTHIPQPLDAGTQLLDLSGNEIQLIPDDSFATAQLLNLQKVYLARCHLRLIERHAFRKLINLVE 164

Human   139 LELFDNRLTTVPTQAFEYLSKLRELWLRNNPIESIPSYAFNRVPSLRRLDLGELKRLEYISEAAF 203
            |:|..|.|:.:|:.|..::|:||||.|..|||..:|..||..||.|.:|:|.:. ||.:|:..||
  Fly   165 LDLSQNLLSAIPSLALYHVSELRELRLSGNPILRVPDDAFGHVPQLVKLELSDC-RLSHIAVRAF 228

Human   204 EGLVNLRYLNLGMCNLKDIPNLTALVRLEELELSGNRLDLIRPGSFQGLTSLRKLWLMHAQVATI 268
            .||.:                     .||.|:|.||||..:|.|:...|.|              
  Fly   229 AGLES---------------------SLEWLKLDGNRLSEVRSGTITSLAS-------------- 258

Human   269 ERNAFDDLKSLEELNLSHNNLMSLPHDLFTPLHRLERVHLNHNPWHCNCDVLWL-SWWLKETVPS 332
                                           ||.||   |..|.|:|:|.:..| :|.|::.:||
  Fly   259 -------------------------------LHGLE---LARNTWNCSCSLRPLRAWMLQQNIPS 289

Human   333 NTTCCARCHAPAGLKGRYIGELDQSHFTCYAPVIVEPPTDLNVTEGMAAELKCRT-GTSMTSVNW 396
            ...  ..|.:|..|.||...:||...|.| .|.||...|..:..||....:.|.. |....:|.|
  Fly   290 GIP--PTCESPPRLSGRAWDKLDVDDFAC-VPQIVATDTTAHGVEGRNITMSCYVEGVPQPAVKW 351

Human   397 L-------------------TPNGTLMTHGSYRVRISVLHDGTLNFTNVT--VQDTGQYTCMVTN 440
            |                   .|.....|.|.....:::|.:.: |.|.:|  :||.|.|||...|
  Fly   352 LLKNRLIANLSAGGDGDSDSEPRTAAATQGRKTYVVNMLRNAS-NLTILTADMQDAGIYTCAAEN 415

Human   441 SAGNTTASATLNVSAVDPVAAGGTGSGGGGPGG-----SGGVG-----GGSGGYTYFTTVTVETL 495
            .||...||.||.||...|.|          |.|     .|.|.     |||.    |..:.:.:|
  Fly   416 KAGKVEASVTLAVSRRPPEA----------PWGVRIILLGAVAALLLVGGSS----FAAICLCSL 466

Human   496 ETQPGEEALQPRGTEKEPPGPTTDGVWGGGRPGDAAGPASSSTTAPAPRSSRPTEKAFTVPITDV 560
            :.:   ..|:               :|               .:.|..|.|...||      .::
  Fly   467 QRR---RKLR---------------LW---------------NSVPPVRRSESYEK------IEM 492

Human   561 TENALKDLDDVMKTTKIIIGCFVAITFMAAVMLVAFYKLRKQHQLHKHHGPTRTVEIINVEDELP 625
            |.....||           |...:....:|.....|:...:|..|...|.|      :|..|...
  Fly   493 TARTRPDL-----------GGGASCGGGSATGAGLFHDAEEQGYLRAAHTP------LNDNDAGQ 540

Human   626 AASAVSVAAAAAVASGGGVGGDSHLALPALERDHLNHHHYVAAAFKAHYSSNP------------ 678
            ||:.|:.:|.:|....|.....|.......|...|:||.....|.:.|...|.            
  Fly   541 AAAIVNPSAGSAQRRNGDYLHVSTHCDDEEEDQQLHHHPQQQPASQHHPHPNQQQHQQRKGSQGH 605

Human   679 --SGGGCGGKGPPGLNSIHEPLLFKSGSKENVQET 711
              |..|.....|.....:|.|.|...|..::...:
  Fly   606 VVSASGANNSAPLEETDLHIPRLIDIGGTDSASSS 640

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LRRC4BNP_001073926.1 LRRNT 57..90 CDD:214470 9/34 (26%)
LRR <76..297 CDD:227223 63/222 (28%)
LRR 1 87..108 9/22 (41%)
leucine-rich repeat 88..111 CDD:275380 10/24 (42%)
LRR 2 111..132 7/20 (35%)
leucine-rich repeat 112..135 CDD:275380 8/22 (36%)
LRR 3 135..156 7/20 (35%)
leucine-rich repeat 136..159 CDD:275380 7/22 (32%)
LRR 4 159..180 11/20 (55%)
leucine-rich repeat 160..183 CDD:275380 12/22 (55%)
LRR 5 183..205 8/21 (38%)
leucine-rich repeat 184..208 CDD:275380 10/23 (43%)
LRR 6 208..229 0/20 (0%)
leucine-rich repeat 209..230 CDD:275380 0/20 (0%)
LRR 7 230..251 10/20 (50%)
leucine-rich repeat 231..254 CDD:275380 11/22 (50%)
LRR 8 254..275 1/20 (5%)
leucine-rich repeat 255..278 CDD:275380 0/22 (0%)
LRR 9 278..299 0/20 (0%)
leucine-rich repeat 279..300 CDD:275380 0/20 (0%)
LRRCT 311..361 CDD:214507 17/50 (34%)
I-set 364..453 CDD:254352 31/110 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 497..551 5/53 (9%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 694..713 4/17 (24%)
kek3NP_001162986.1 LRR_RI <110..267 CDD:238064 66/226 (29%)
leucine-rich repeat 112..137 CDD:275380 10/24 (42%)
LRR_8 137..196 CDD:290566 22/58 (38%)
leucine-rich repeat 138..161 CDD:275380 8/22 (36%)
leucine-rich repeat 162..185 CDD:275380 7/22 (32%)
LRR_8 184..245 CDD:290566 30/82 (37%)
leucine-rich repeat 186..209 CDD:275380 12/22 (55%)
leucine-rich repeat 210..234 CDD:275380 10/45 (22%)
leucine-rich repeat 235..258 CDD:275380 11/22 (50%)
LRRCT 267..316 CDD:214507 17/50 (34%)
IG_like 328..428 CDD:214653 27/100 (27%)
Ig 335..425 CDD:143165 23/90 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm41933
orthoMCL 1 0.900 - - OOG6_104601
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5308
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.