DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GRAP2 and Cip4

DIOPT Version :9

Sequence 1:NP_001278753.1 Gene:GRAP2 / 9402 HGNCID:4563 Length:330 Species:Homo sapiens
Sequence 2:NP_001097501.1 Gene:Cip4 / 38534 FlyBaseID:FBgn0035533 Length:665 Species:Drosophila melanogaster


Alignment Length:396 Identity:83/396 - (20%)
Similarity:122/396 - (30%) Gaps:118/396 - (29%)


- Green bases have known domain annotations that are detailed below.


Human     1 MEAVAKFDFTASGEDELSFHTGDVLKILSNQEEWFKAELGSQEGYVPKNFIDIQFPKWFHEGLSR 65
            ||.:.|     :||.            ::.:|:.||.....|.|:.|..  ||.|     |.||:
  Fly   311 MEGIVK-----AGES------------INEKEDTFKVIERYQSGFTPPR--DIPF-----EDLSK 351

Human    66 ------------HQAENLL----------MGKEVGFFIIRASQSSPGDFSISVRHEDDVQHFKVM 108
                        :...|.|          :.|.||.|.|..|..:      |:..:...:.|..:
  Fly   352 CDPDSVQDSHYSNSTSNHLTIRGTMSANKLKKRVGIFNIFGSNKN------SLTADGQKEDFSDL 410

Human   109 RDNK-------------GNYFLWTEKFPSLNKLVDYYRTNSI-------------SRQKQIFLRD 147
            ..|:             .|....|:....|.|:...|..||.             |..|...|:.
  Fly   411 PPNQRRKKLQAKIAELTQNIAQETKARDGLMKMKIVYEANSSLGNPMTVEGQLNESEHKLEKLKV 475

Human   148 RTREDQGHRGNSLDRRSQ-----GGPHLSG---AVGEEIRPSMNRKLSDHPPTLPLQQHQHQPQP 204
            ..::.||.    |::.||     ..|..|.   ..|.......|....||          |....
  Fly   476 DLKKYQGF----LEKASQVPTATSSPQASRNQLQNGHRTSRHSNGSADDH----------HDDGD 526

Human   205 PQYAPAPQQLQQPPQQRYLQHHHFHQERRGGSLDINDG----HC---GTGLGSEMNAALMHRRH- 261
            .|...|....:...:....|..:.|.....||.....|    |.   |:|.||....|:....: 
  Fly   527 DQPDDAGSLSRSDSEDNVAQIQNGHNNNNNGSASPESGLGTSHTSLPGSGQGSANENAIGEDTYY 591

Human   262 -TDPVQLQAAGRVRWARALYDFEALEDDELGFHSGEVVEVLDSSNPSWWTG-RLHNKL-----GL 319
             |:...|...|:   .||||.|||..:..:....||.::|::......||. |..|..     |.
  Fly   592 ETEVETLNPVGK---CRALYPFEASSEGSIPMSEGEELQVIEIDQGDGWTRVRRENNSNGWDEGF 653

Human   320 FPANYV 325
            .|.:|:
  Fly   654 VPTSYI 659

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GRAP2NP_001278753.1 SH3_GRAP2_N 2..53 CDD:212880 10/50 (20%)
SH2_Grb2_like 54..147 CDD:199828 25/140 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 143..244 20/112 (18%)
SH3_GRAP2_C 275..327 CDD:212883 17/57 (30%)
Cip4NP_001097501.1 F-BAR_CIP4-like 69..319 CDD:153337 3/12 (25%)
HR1_CIP4-like 412..488 CDD:212009 14/79 (18%)
SH3_CIP4-like 603..661 CDD:212844 17/60 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2056
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.