DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LIPG and CG6295

DIOPT Version :9

Sequence 1:XP_005258447.1 Gene:LIPG / 9388 HGNCID:6623 Length:536 Species:Homo sapiens
Sequence 2:NP_651521.1 Gene:CG6295 / 43247 FlyBaseID:FBgn0039471 Length:338 Species:Drosophila melanogaster


Alignment Length:287 Identity:88/287 - (30%)
Similarity:136/287 - (47%) Gaps:49/287 - (17%)


- Green bases have known domain annotations that are detailed below.


Human   107 SQPLEDCSFNMTAKTFFIIHGWTMS-------GIFENWLHKLVSALHTREKDANVVVVDWLPLAH 164
            |..:....||....|.|.||||:.|       |:.:.|.         ...|.|::.|||.....
  Fly    84 SASISGSHFNPNHPTRFTIHGWSSSKDEFINYGVRDAWF---------THGDMNMIAVDWGRARS 139

Human   165 QLYTDAVNNTRVVGHSIARMLDWLQEKDDFSLGNVHLIGYSLGAHVAGYAGNFVK-GTVGRITGL 228
            ..|..:|.....||..:|.::::::.....:|.|..:||:||||||:||||..|| |.:..|.||
  Fly   140 VDYASSVLAVPGVGEQVATLINFMRSNHGLNLDNTMVIGHSLGAHVSGYAGKNVKNGQLHTIIGL 204

Human   229 DPAGPMFEGADIHKRLSPDDADFVDVLHTYTRSFGLSIGIQMPVGHIDIYPNGGDFQPGCGLNDV 293
            |||.|:|.....:||||..||.:|:.:.|.    |.::|...|:|....|||||..|||||: |:
  Fly   205 DPALPLFSYDSPNKRLSSTDAYYVESIQTN----GGTLGFLKPIGKGAFYPNGGKSQPGCGV-DL 264

Human   294 LGSIAYGTITEVVKCEHERAVHLFVDSLVNQDKPSFAFQCTDSNRFKKGICLSCRKNRCNSIGYN 358
            .||           |.|.|:|..:.:|:...:.|:  .:|.|   :::.:...|..:      |:
  Fly   265 TGS-----------CAHSRSVIYYAESVTENNFPT--MRCGD---YEEAVAKECGSS------YS 307

Human   359 AKKMRNKRNSKM-----YLKTRAGMPF 380
            :.:|....|:.|     |:..|:..|:
  Fly   308 SVRMGATTNAYMVAGDYYVPVRSDAPY 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LIPGXP_005258447.1 Pancreat_lipase_like 85..376 CDD:238363 86/281 (31%)
lipo_lipase 86..521 CDD:132274 88/287 (31%)
PLAT_LPL 383..519 CDD:238856
CG6295NP_651521.1 Pancreat_lipase_like 64..330 CDD:238363 86/281 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165145238
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.