DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SLC22A8 and CG31103

DIOPT Version :9

Sequence 1:NP_001171661.1 Gene:SLC22A8 / 9376 HGNCID:10972 Length:542 Species:Homo sapiens
Sequence 2:NP_001097914.1 Gene:CG31103 / 43030 FlyBaseID:FBgn0051103 Length:506 Species:Drosophila melanogaster


Alignment Length:490 Identity:106/490 - (21%)
Similarity:173/490 - (35%) Gaps:144/490 - (29%)


- Green bases have known domain annotations that are detailed below.


Human    99 WVYNSTKDSI---VTEWDLVCNSNKL------KEMAQSIF----------------------MAG 132
            |.|:...:.|   .|:|.|:..|..|      .:.|.||.                      :.|
  Fly    15 WDYDMVLEKIGYGKTQWVLLLVSGLLTITSVAAQQAMSIIVIASQCEFETTQAEKGVMMAASVTG 79

Human   133 ILIGGLVLGDLSDRFGRRPIL-----------------TCSYL-----LLAASGSGAAFSPTFPI 175
            |.:...:.|.:||..|||.:|                 |..:|     ||.....||..:     
  Fly    80 IFLSTYIWGYISDDIGRRRVLLYGNFASNALQFVLMFVTSVWLFNIINLLVGISVGAVSA----- 139

Human   176 YMVFRFLCGFGIS-----GITLSTVILNVE--WVPTRMRAIMSTALGYCYTFGQFILPGLAYAIP 233
             .::.:|..|.|.     .|..||:.::|.  :||.....::|:  .:..|.|.|:       ..
  Fly   140 -ALYAYLSEFNIPRHRAVAINYSTMFVSVTAIYVPATAWLVLSS--NWAITMGDFV-------FR 194

Human   234 QWRWLQLTVSIPFFVFFLSSWWTPESIRWLVLSGKSSKALKILRRVAVFNGKKEEGERLSLEELK 298
            .||.|.|...:|.|:..|...:.|||.::|:...|:::|::.:..::.||..|...:.||.:|..
  Fly   195 PWRLLLLVSLLPGFIGGLILLYYPESPKFLLSQEKNNEAIEAVAWISKFNRGKSIQQVLSCDEFT 259

Human   299 LNLQKEIS------------LAKAKYTASDLFRIPMLRRMTFC-LSL-----------AWF---- 335
            |..:..:.            |:|.......||..|.......| |:|           .||    
  Fly   260 LKSEDPVGENLLGESQGCGILSKICRATIPLFHKPHGFNFILCNLALFGMFFSSNGMQLWFPEIV 324

Human   336 --ATGFAYYS------LAMGVEEFGV------------NLYILQIIFGGVDVPAKFITILSLSYL 380
              ::|....|      |::.||:..|            ..||..::.|...:....|..|.|:.|
  Fly   325 NRSSGAENNSSTVCEILSVPVEQPNVTETLDCTDPISSKTYIDNLVVGFAFLIGFSIQGLILNPL 389

Human   381 GRHTTQAAALLLAGGAILALTFVPLDLQTVRTVLAVFGKGCL-----SSSFSCLFLYTSELYPTV 440
            ||.....|||.:|..:.:.|.|    :::...||.:|   ||     ..|.|.:.....:|.||.
  Fly   390 GRKNVLLAALAVATLSGVLLHF----MESPTGVLVLF---CLYILLPGLSISIMIGAIVDLVPTH 447

Human   441 IRQTG---------MGVSNLWTRVGSMVSPLVKIT 466
            :|...         :|:......:|.|:.|....|
  Fly   448 LRSKAVSFCMSLGRLGIIAATNLMGVMLQPYCNTT 482

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SLC22A8NP_001171661.1 2A0119 11..503 CDD:273328 106/490 (22%)
MFS 96..493 CDD:119392 106/490 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 515..542
CG31103NP_001097914.1 2A0115 29..475 CDD:273327 100/467 (21%)
MFS 34..>189 CDD:119392 31/162 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165153402
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.