DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SLC22A8 and CG33233

DIOPT Version :9

Sequence 1:NP_001171661.1 Gene:SLC22A8 / 9376 HGNCID:10972 Length:542 Species:Homo sapiens
Sequence 2:NP_995978.2 Gene:CG33233 / 2769005 FlyBaseID:FBgn0053233 Length:489 Species:Drosophila melanogaster


Alignment Length:457 Identity:99/457 - (21%)
Similarity:180/457 - (39%) Gaps:90/457 - (19%)


- Green bases have known domain annotations that are detailed below.


Human   111 EWDLVCNSNKLKEMAQSIFMAGILIGGLVLGDLSDRFGRRPILTCSYLLLAASGSGAAFSPTFP- 174
            |:|   .|.|.|.:..:..:.|::..||.:|.|:||:||:.::.   |.|..:.|.:..|...| 
  Fly    50 EFD---TSPKEKTLLANSLLGGMVASGLFIGFLADRYGRKFVIR---LALVGALSFSVISALMPD 108

Human   175 IY--MVFRFLCGFGISGI-TLSTVILN----VEWVPTRMRAIMSTALG----YCYTFGQFILP-- 226
            :|  .|.|.:.|..:|.: :|....|.    ::|.|..: ||.|.:.|    ||......|||  
  Fly   109 LYSLSVIRIIVGTFLSAVASLQVGFLGEFHAIKWRPITV-AICSQSQGLALIYCPLVAMAILPNN 172

Human   227 -----GLAYAIPQWRWLQLTVSIPFFVFFLSSWWTPESIRWLVLSGKSSKALKILRRVAVFNGKK 286
                 ..:|.:..||:|.:...||.::..:.....||:..:|:...:..|||..|:.:...|.||
  Fly   173 FNVDLSSSYNLRVWRFLMMFFMIPGWLALVGICLVPETPHFLMSVNRPDKALLALKWICRMNRKK 237

Human   287 EEGERLSLEELKLNLQKEISLAKAK-YTASDLFRIPMLRRMTFCLSLAWFATGFAYYSLAMGV-- 348
            .|...::|.|.|.:...:....|.. |....||..|.:.:...||.|.:   |..:.|:.:|:  
  Fly   238 WEDVDITLSEEKSSTNDQEGFWKTVWYEYKLLFSKPHVFKFFICLFLIF---GIFFTSIGLGIWF 299

Human   349 ------EEFGVNL-----------------------------------YILQIIFGGVDVPAKFI 372
                  :..|.|.                                   .|..:.:|...:....:
  Fly   300 PVIRNMDNSGSNRLCDLVNNNPTFINHEADDTNGTDSESPKCNDEMTNLIDPVYYGFTYIGCFIL 364

Human   373 TILSLSYLGRHTTQAAALLLAGGAILALTFVPLDLQTVRTVLAVFGKGCLSSSFSCLFLYTSEL- 436
            ..:.:.::.|....|..:|::  .||.::   |::....||:.:|....:......:.|.||.| 
  Fly   365 ASVLVHWMTRKYVIALHILIS--MILGIS---LNIMKQPTVVLIFFVLMMVLPGVLIPLATSVLV 424

Human   437 --YPTVIRQTGMGVSNLWTRVG-----SMVSPLVKITGEVQPFIPNIIYGITALLGGSAALFLPE 494
              .|..:|...:.:.....|.|     :|:...:::|.:|...|.|:...|..:|    |:|.|:
  Fly   425 DCLPVNLRGKALCMVRSLARFGGVLGSTMIGLFIRVTCDVTFNIFNLCLAICVVL----AVFQPK 485

Human   495 TL 496
            .:
  Fly   486 DI 487

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SLC22A8NP_001171661.1 2A0119 11..503 CDD:273328 99/457 (22%)
MFS 96..493 CDD:119392 98/452 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 515..542
CG33233NP_995978.2 MFS_1 22..451 CDD:284993 89/415 (21%)
MFS 23..>208 CDD:119392 43/164 (26%)
MFS 354..>482 CDD:304372 26/136 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165153399
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.