DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PPT2 and Ppt1

DIOPT Version :9

Sequence 1:NP_619731.2 Gene:PPT2 / 9374 HGNCID:9326 Length:308 Species:Homo sapiens
Sequence 2:NP_001285024.1 Gene:Ppt1 / 31805 FlyBaseID:FBgn0030057 Length:314 Species:Drosophila melanogaster


Alignment Length:320 Identity:79/320 - (24%)
Similarity:126/320 - (39%) Gaps:58/320 - (18%)


- Green bases have known domain annotations that are detailed below.


Human     7 MLGLCGQRLPAAWVLLLLPFLPLLLLAAPAPHRASYK----PVIVVHGLFDS---SYSFRHLLEY 64
            |:.:|..|......||.|.|..:|.....:|.:....    ||::.||:.|:   .:|...::..
  Fly     1 MISICCSRFSCILFLLFLIFSLVLSYIWWSPTKGGTNPEVLPVVLWHGMGDTCCVPFSLGAIMNL 65

Human    65 INETHPGTVVTVLD-----LFDGRESLRPLWEQVQGF----REAVVPIMAKAPQ------GVHLI 114
            |.|...|..|..|.     |.|        |:  .||    .|.|..:..:..|      |.|.|
  Fly    66 IVEQTKGGYVRSLQIGGNVLID--------WQ--SGFFIHPNEQVDYVCKQLLQDEHLAKGYHAI 120

Human   115 CYSQGGLVCRALLSVMDDHNVDSFISLSSPQMGQYG----------DTDYLKWLFPTSMRSNLYR 169
            .:||||...||:.....:..:.:.|:|.....|.:|          ..||:..|        |..
  Fly   121 GFSQGGQFLRAVAERCPNPPMRNLITLGGQHQGIFGLPMCPTLTEKPCDYITRL--------LDN 177

Human   170 ICYSPWGQEFSI-CNYWHDPHHDDLYLNASSFLALINGERDHPNATVWRKNFLRVGHLVLIGGPD 233
            ..|:|..|:..: ..|||||..::.|...|:|||.||.|.......:  :|..::...|::...:
  Fly   178 AAYAPEVQKALVQATYWHDPIMENKYRLGSTFLADINNELFINKFYI--ENLQKLKKFVMVQFLN 240

Human   234 DGVITPWQSSFFGFYDA--NETVLEMEEQLVYLRDSFGLKTLLARGAIVRCPMAGISHTA 291
            |.::.|.:|.:|.:|..  |:.:....|..||  ...||..:..:|.:|...:.| .|.|
  Fly   241 DTIVQPKESQWFQYYTTGQNKVIQPFTESKVY--QDLGLDKMHRQGQLVFLGVEG-DHLA 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PPT2NP_619731.2 Abhydrolase 44..286 CDD:304388 67/272 (25%)
Ppt1NP_001285024.1 Abhydrolase 38..311 CDD:304388 70/283 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1075
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54894
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X458
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.