DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NHERF1 and CG6688

DIOPT Version :10

Sequence 1:NP_004243.1 Gene:NHERF1 / 9368 HGNCID:11075 Length:358 Species:Homo sapiens
Sequence 2:NP_651110.1 Gene:CG6688 / 42716 FlyBaseID:FBgn0039038 Length:424 Species:Drosophila melanogaster


Alignment Length:122 Identity:34/122 - (27%)
Similarity:54/122 - (44%) Gaps:17/122 - (13%)


- Green bases have known domain annotations that are detailed below.


Human    24 YGFHLHGEKGKLGQYIRLVEPGSPAEKAGLLAGDRLVEVNGENVEKETHQQVVSRIRAALNAVRL 88
            |||.|...|.....::..|..|:||...||..||.::||||.:|......::...:::..:.|.:
  Fly    39 YGFQLTRSKWDPYPWVCEVAAGTPAALCGLKPGDCVLEVNGNDVLGLRVSEIAKMVKSQKDCVTI 103

Human    89 LVVDPETDE--------------QLQKLGVQVREELLRAQEAP--GQAEPPAAAEVQ 129
            |..:.|.|:              .|::|.: |.|.:||..|.|  |....|.|.:.|
  Fly   104 LCWNSECDKDCDTNSICCAPMPTSLRRLSL-VLESILRLVECPVCGVTISPPAMQCQ 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NHERF1NP_004243.1 PDZ_NHERF-like 13..92 CDD:467249 20/67 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 114..192 6/18 (33%)
PDZ_NHERF-like 153..232 CDD:467249
EBP50_C 235..358 CDD:462654
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 277..358
CG6688NP_651110.1 PDZ_canonical 25..104 CDD:483948 19/64 (30%)
RING-HC_SIAHs 143..179 CDD:438233 6/17 (35%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.