DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SLC9A3R1 and nrfl-1

DIOPT Version :9

Sequence 1:NP_004243.1 Gene:SLC9A3R1 / 9368 HGNCID:11075 Length:358 Species:Homo sapiens
Sequence 2:NP_741479.1 Gene:nrfl-1 / 177736 WormBaseID:WBGene00006438 Length:608 Species:Caenorhabditis elegans


Alignment Length:380 Identity:94/380 - (24%)
Similarity:147/380 - (38%) Gaps:84/380 - (22%)


- Green bases have known domain annotations that are detailed below.


Human    11 LPRLCCLEKG--PNGYGFHLHGEKGKLGQYIRLVEPGSPAEKAGLLAGDRLVEVNGENVEKET-H 72
            ||||..|.||  ...:||:||.|:|: |.:|..|:.|...|||||.||.|:|.|||:.:...| |
 Worm   281 LPRLAELNKGTPDQEFGFNLHAERGR-GHFIGTVDAGGIGEKAGLEAGQRIVGVNGQLIYPTTGH 344

Human    73 QQVVSRIRAALNAVRLLVVDPETD------------EQLQKLGVQV--------REELLRAQEAP 117
            ::||:.|:.......|||...:.|            :.::::..:.        ..|.:...::.
 Worm   345 KEVVALIKKDTMKTTLLVASEDVDKYHKDHNIAYSWDNVERVDTRPVINVETHHHHEEVSVPKSN 409

Human   118 GQAEPPA---AAEVQGAGNENEPREADKSHPEQRELRPRLCTMKKGPSGYGFNLHSDKSKPGQFI 179
            |...||.   :.:|      ||.||..|     .....|..|:....|.|.:     |.....:.
 Worm   410 GYDVPPLNPHSIQV------NEEREISK-----MTTTTRTETITNSNSAYQY-----KESSTAYD 458

Human   180 RSVDPDSPAEASGLRAQDRI---VEVNGVCMEGKQHGDVVSAIRAGGDETKLLVVDRETDEFFKK 241
            ....|  |.:::.|  .|.:   |.:.||.|  ..|.:|:.                .||:.   
 Worm   459 AYATP--PVDSNDL--MDEVFGRVNLPGVTM--SSHTEVLP----------------PTDDI--- 498

Human   242 CRVIPSQEHLNGPLPVPFTNGEIQKENSREALAEAALESPRPALVRSASSDTSEELNSQDSPPKQ 306
            ..|.....|....:.||.         |.:.:...|.||.:.....|.:.....: :.|.||...
 Worm   499 SSVSSLSSHRESAVDVPV---------SHQYVPSYATESHQKHEQHSQTHHHHHQ-HQQPSPLSN 553

Human   307 DST---APSSTSSSDPILDFNISLAMAKERAHQKRSSKRAPQMDWSKKNELFSNL 358
            .|:   |.||||..|....:::|...|:||...|.......:|..::|.:|.||:
 Worm   554 GSSHGYAASSTSGYDDDDIYHLSAREARERLRMKNRKHHLHEMSLNEKYQLVSNM 608

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SLC9A3R1NP_004243.1 PDZ_signaling 12..91 CDD:238492 35/81 (43%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 114..192 16/80 (20%)
PDZ_signaling 152..231 CDD:238492 15/81 (19%)
EBP50_C 235..358 CDD:312529 30/125 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 277..358 23/83 (28%)
nrfl-1NP_741479.1 PDZ_signaling 282..363 CDD:238492 35/81 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 53 1.000 Domainoid score I8298
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 130 1.000 Inparanoid score I3623
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D377274at33208
OrthoFinder 1 1.000 - - FOG0002256
OrthoInspector 1 1.000 - - otm15002
orthoMCL 1 0.900 - - OOG6_106590
Panther 1 1.100 - - LDO PTHR14191
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5127
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1010.000

Return to query results.
Submit another query.