DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RAB9A and Rab9

DIOPT Version :9

Sequence 1:NP_001182257.1 Gene:RAB9A / 9367 HGNCID:9792 Length:201 Species:Homo sapiens
Sequence 2:NP_062747.1 Gene:Rab9 / 56382 MGIID:1890695 Length:201 Species:Mus musculus


Alignment Length:201 Identity:192/201 - (95%)
Similarity:199/201 - (99%) Gaps:0/201 - (0%)


- Green bases have known domain annotations that are detailed below.


Human     1 MAGKSSLFKVILLGDGGVGKSSLMNRYVTNKFDTQLFHTIGVEFLNKDLEVDGHFVTMQIWDTAG 65
            |||||||||:|||||||||||||||||||||||:|||||||||||||||||||||||||||||||
Mouse     1 MAGKSSLFKIILLGDGGVGKSSLMNRYVTNKFDSQLFHTIGVEFLNKDLEVDGHFVTMQIWDTAG 65

Human    66 QERFRSLRTPFYRGSDCCLLTFSVDDSQSFQNLSNWKKEFIYYADVKEPESFPFVILGNKIDISE 130
            ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||.||.|
Mouse    66 QERFRSLRTPFYRGSDCCLLTFSVDDSQSFQNLSNWKKEFIYYADVKEPESFPFVILGNKTDIKE 130

Human   131 RQVSTEEAQAWCRDNGDYPYFETSAKDATNVAAAFEEAVRRVLATEDRSDHLIQTDTVNLHRKPK 195
            ||||||||||||:||||||||||||||:|||||||||||||:|||||||:|||||||||||||||
Mouse   131 RQVSTEEAQAWCKDNGDYPYFETSAKDSTNVAAAFEEAVRRILATEDRSEHLIQTDTVNLHRKPK 195

Human   196 PSSSCC 201
            |:||||
Mouse   196 PNSSCC 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RAB9ANP_001182257.1 Rab9 3..172 CDD:206697 162/168 (96%)
Effector region. /evidence=ECO:0000250 36..44 7/7 (100%)
Rab9NP_062747.1 Rab9 3..172 CDD:206697 162/168 (96%)
Effector region. /evidence=ECO:0000250 36..44 7/7 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C83973221
Domainoid 1 1.000 332 1.000 Domainoid score I14405
eggNOG 1 0.900 - - E1_KOG0394
HGNC 1 1.500 - -
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H20900
Inparanoid 1 1.050 403 1.000 Inparanoid score I13632
Isobase 00.000 Not matched by this tool.
NCBI 1 1.000 - -
OMA 1 1.010 - - QHG52476
OrthoDB 1 1.010 - - D1172019at2759
OrthoFinder 1 1.000 - - FOG0004055
OrthoInspector 1 1.000 - - oto114464
orthoMCL 1 0.900 - - OOG6_105995
Panther 1 1.100 - - LDO PTHR47981
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2801
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1818.270

Return to query results.
Submit another query.