DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RAB9A and Rab9

DIOPT Version :9

Sequence 1:NP_001182257.1 Gene:RAB9A / 9367 HGNCID:9792 Length:201 Species:Homo sapiens
Sequence 2:NP_609966.1 Gene:Rab9 / 35221 FlyBaseID:FBgn0032782 Length:256 Species:Drosophila melanogaster


Alignment Length:207 Identity:103/207 - (49%)
Similarity:139/207 - (67%) Gaps:13/207 - (6%)


- Green bases have known domain annotations that are detailed below.


Human     4 KSSLFKVILLGDGGVGKSSLMNRYVTNKFDTQLFHTIGVEFLNKDLEVDGHFVTMQIWDTAGQER 68
            ||.|.||::|||||||||:|:.|:|.|:::...||||||||:|||:.|||...|:||||||||||
  Fly     9 KSKLLKVVILGDGGVGKSALLTRFVANRYEENNFHTIGVEFMNKDIVVDGERYTLQIWDTAGQER 73

Human    69 FRSLRTPFYRGSDCCLLTFSVDDSQSFQNLSNWKKEFIYYADVKEPESFPFVILGNKIDI--SER 131
            ||:||||||||||.|||.:::||..|.:.|..|:.||:.|||| :.:.|||:::|||.||  .:|
  Fly    74 FRALRTPFYRGSDICLLCYALDDRDSLKGLGVWRNEFLNYADV-DQDKFPFIVVGNKNDIPAQKR 137

Human   132 QVSTEEAQAWCRDNGDYPYFETSAKDATNVAAAFEEAVRR-----VLATEDRSDHLIQTDTVNLH 191
            |||::..|.||.:.....:.|||:|.||||..||...:|:     .:|..:...|   .||::|.
  Fly   138 QVSSDAVQQWCAEQKVACHIETSSKAATNVTDAFVLGLRQWRHMECVAEAELRQH---GDTIDLT 199

Human   192 RKPK--PSSSCC 201
            |..:  ....||
  Fly   200 RPIRLVQRRICC 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RAB9ANP_001182257.1 Rab9 3..172 CDD:206697 95/174 (55%)
Effector region. /evidence=ECO:0000250 36..44 6/7 (86%)
Rab9NP_609966.1 Rab9 8..178 CDD:206697 95/169 (56%)
Ras 14..177 CDD:278499 91/163 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0394
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S534
OMA 1 1.010 - - QHG52476
OrthoDB 1 1.010 - - D1172019at2759
OrthoFinder 1 1.000 - - FOG0004055
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_105995
Panther 1 1.100 - - O PTHR47981
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5468
SonicParanoid 1 1.000 - - X2801
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1211.770

Return to query results.
Submit another query.