DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ZFAND4 and MDY2

DIOPT Version :9

Sequence 1:XP_016872420.1 Gene:ZFAND4 / 93550 HGNCID:23504 Length:741 Species:Homo sapiens
Sequence 2:NP_014530.1 Gene:MDY2 / 854038 SGDID:S000005471 Length:212 Species:Saccharomyces cerevisiae


Alignment Length:89 Identity:25/89 - (28%)
Similarity:39/89 - (43%) Gaps:19/89 - (21%)


- Green bases have known domain annotations that are detailed below.


Human   216 DEETEPSSSGQQIIENSITMNKMK-------LLKAKMKNMNLSKKPKK--------AVKIKPHPP 265
            :.:..||.:..||.::.|:..|..       |||.|:.:.||.....|        .|.|||:|.
Yeast    89 EHDFSPSDTILQIKQHLISEEKASHISEIKLLLKGKVLHDNLFLSDLKVTPANSTITVMIKPNPT 153

Human   266 VAPRP----SSGSTAPSRHRLLRV 285
            ::..|    |:.|.||:..:.|.|
Yeast   154 ISKEPEAEKSTNSPAPAPPQELTV 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZFAND4XP_016872420.1 None
MDY2NP_014530.1 Get5_bdg 8..59 CDD:407090
Ubl_Rad23 74..148 CDD:340503 14/58 (24%)
Get5_C 174..212 CDD:408303 2/4 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5272
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.