DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ZFAND4 and ubi3

DIOPT Version :9

Sequence 1:XP_016872420.1 Gene:ZFAND4 / 93550 HGNCID:23504 Length:741 Species:Homo sapiens
Sequence 2:NP_594108.1 Gene:ubi3 / 2541445 PomBaseID:SPAC6G10.11c Length:150 Species:Schizosaccharomyces pombe


Alignment Length:211 Identity:52/211 - (24%)
Similarity:74/211 - (35%) Gaps:86/211 - (40%)


- Green bases have known domain annotations that are detailed below.


Human    84 MELFIETLTGTCFELRVSPFETVISVKAKIRRLE-VPTDDPLRKMAEYLDSSRVEVWEKTSCSKQ 147
            |::|::||||....|.|...:|:.:||:||:..| :|.|                       .::
pombe     1 MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPD-----------------------QQR 42

Human   148 VTFLVYQEGDQLNFFPAVDRGDGTLTPLSDSSKKIDFHLH-VLRRKGEHRMSYCFLCSGGSMYNS 211
            :.|    .|.||.        ||  ..|||.:.:.:..|| |||.:|           ||.....
pombe    43 LIF----AGKQLE--------DG--RTLSDYNIQKESTLHLVLRLRG-----------GGKKRKK 82

Human   212 DTDEDEETEPSSSGQQIIENSITMNKMKLLKAKMKNMNLSKKPKKAVKIKPHPPVAPRPSSGSTA 276
            .|    .|.|                 |.:|.|.|.:.|:  ..|..|::         ..||. 
pombe    83 KT----YTTP-----------------KKIKHKHKKVELA--VLKYYKVE---------DDGSV- 114

Human   277 PSRHRLLRVLPNIGQS 292
               .||.|..||.|.|
pombe   115 ---KRLRRECPNCGAS 127

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZFAND4XP_016872420.1 None
ubi3NP_594108.1 Ubiquitin 1..76 CDD:176398 31/122 (25%)
UBQ 1..71 CDD:214563 27/106 (25%)
Ribosomal_S27 103..145 CDD:279879 11/38 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5272
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.