DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ZFAND4 and rhp23

DIOPT Version :9

Sequence 1:XP_016872420.1 Gene:ZFAND4 / 93550 HGNCID:23504 Length:741 Species:Homo sapiens
Sequence 2:NP_596231.1 Gene:rhp23 / 2540481 PomBaseID:SPBC2D10.12 Length:368 Species:Schizosaccharomyces pombe


Alignment Length:259 Identity:51/259 - (19%)
Similarity:85/259 - (32%) Gaps:78/259 - (30%)


- Green bases have known domain annotations that are detailed below.


Human   254 PKKAVKIKPHPPVAPRPSSGSTAPSRHRLLRVLPNIGQSCSPAFGNAYPPEISRNGISSLATQLS 318
            ||.|....|:|| |..|.....|||        ..:.:|.|..      ..::....|:..|..:
pombe    82 PKSAASPAPNPP-ASVPEKKVEAPS--------STVAESTSTT------QTVAAAAPSNPDTTAT 131

Human   319 AERYISSITGEFLKEDNSWENNTLS-HFSSNVKLPPQIPHLELGNDQELADSVLHLGSSLP-RQT 381
            :|..|.:              |||: ....||.:...:   |:|.::...:..:....:.| |..
pombe   132 SEAPIDA--------------NTLAVGAQRNVAVENMV---EMGYERSEVERAMRAAFNNPDRAV 179

Human   382 KHFLGNLPSSNGN-------IVLPSEECVTEQSLLP-------KVGSLASFAEGNADEQSSGLEG 432
            ::.|..:|....|       ..|.:::..:| :|.|       .:...|:.:|....||.|...|
pombe   180 EYLLTGIPEDILNRQREESAAALAAQQQQSE-ALAPTSTGQPANLFEQAALSENENQEQPSNTVG 243

Human   433 ACKVN---------------------LELLLTNADKGLKA--------PEQHLKHVAGVLNGES 467
            ...:.                     ||.:|....:|..|        ||..|:.:|....|||
pombe   244 DDPLGFLRSIPQFQQLRQIVQQNPQMLETILQQIGQGDPALAQAITQNPEAFLQLLAEGAEGES 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZFAND4XP_016872420.1 None
rhp23NP_596231.1 rad23 1..363 CDD:273167 51/259 (20%)
RAD23_N 1..76 CDD:176400
UBA1_Rhp23p_like 141..187 CDD:270561 8/48 (17%)
XPC-binding 247..302 CDD:286376 9/54 (17%)
UBA2_Rhp23p_like 321..360 CDD:270564
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5272
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.