DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment LHX2 and lbl

DIOPT Version :9

Sequence 1:	NP_004780.3	Gene:	LHX2 / 9355	HGNCID:	6594	Length:	406	Species:	Homo sapiens
Sequence 2:	NP_001262805.1	Gene:	lbl / 42541	FlyBaseID:	FBgn0008651	Length:	410	Species:	Drosophila melanogaster

Alignment Length:	112	Identity:	27/112 - (24%)
Similarity:	48/112 - (42%)	Gaps:	11/112 - (9%)

- Green bases have known domain annotations that are detailed below.

Human   225 PRKRKSPGP-GADLAAYNAALSC----------NENDAEHLDRDQPYPSSQKTKRMRTSFKHHQL 278
            |:|.....| ||..::.:..|..          .|.|...|:......:.:|.::.||:|.:.|:
  Fly   199 PKKSPEEQPKGASKSSGDTPLDALFQLSTKNFDEEQDPATLNIFATRSNPKKKRKSRTAFTNQQI 263

Human   279 RTMKSYFAINHNPDAKDLKQLAQKTGLTKRVLQVWFQNARAKFRRNL 325
            ..::..|.........|..::|...||:...:..||||.|||.:|::
  Fly   264 FELEKRFLYQKYLSPADRDEIAGGLGLSNAQVITWFQNRRAKLKRDM 310

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
LHX2	NP_004780.3	LIM1_Lhx2	43..106	CDD:188853
		LIM2_Lhx2_Lhx9	111..169	CDD:188763
		COG5576	<247..378	CDD:227863	21/79 (27%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	250..270		3/19 (16%)
		Homeobox	270..323	CDD:395001	16/52 (31%)
		Nuclear localization signal. /evidence=ECO:0000255	307..323		7/15 (47%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	328..374
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	387..406
lbl	NP_001262805.1	COG5576	206..332	CDD:227863	25/105 (24%)
lbl	NP_001262805.1	Homeobox	254..307	CDD:278475	16/52 (31%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.910