powered by:
Protein Alignment LHX2 and MICAL-like
DIOPT Version :9
Sequence 1: | NP_004780.3 |
Gene: | LHX2 / 9355 |
HGNCID: | 6594 |
Length: | 406 |
Species: | Homo sapiens |
Sequence 2: | NP_648621.1 |
Gene: | MICAL-like / 39475 |
FlyBaseID: | FBgn0036333 |
Length: | 1010 |
Species: | Drosophila melanogaster |
Alignment Length: | 52 |
Identity: | 15/52 - (28%) |
Similarity: | 28/52 - (53%) |
Gaps: | 1/52 - (1%) |
- Green bases have known domain annotations that are detailed below.
Human 114 RCARCHLGISASEMVMRARDLVYHLNCFTCTTCNKMLTTGDHFGMKDSLVYC 165
:|.:|:|.:..:|.|:..: ..||..|..|..|:.:||.|..:..:.:.:||
Fly 149 KCQKCNLPVFLAERVLVGK-RAYHRTCLKCARCSSLLTPGSFYETEVNNIYC 199
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.