DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment LHX2 and Zasp52

DIOPT Version :9

Sequence 1:	NP_004780.3	Gene:	LHX2 / 9355	HGNCID:	6594	Length:	406	Species:	Homo sapiens
Sequence 2:	NP_001027420.2	Gene:	Zasp52 / 36740	FlyBaseID:	FBgn0265991	Length:	2194	Species:	Drosophila melanogaster

Alignment Length:	119	Identity:	37/119 - (31%)
Similarity:	55/119 - (46%)	Gaps:	4/119 - (3%)

- Green bases have known domain annotations that are detailed below.

Human    50 AALCAGCGGKISDRYYLLAVDKQWHMRCLKCCECKLNLESELTCFSKDGSIYCKEDYYRRFSVQR 114
            |..|:.|.|||... .|.|:.|.:|..|..|.:|. .:......|.:||:.||:.|:...|:. :
  Fly  2078 APTCSKCAGKIKGD-CLNAIGKHFHPECFTCGQCG-KIFGNRPFFLEDGNAYCEADWNELFTT-K 2139

Human   115 CARCHLGISASEMVMRARDLVYHLNCFTCTTCNKMLTTGDHFGMKDSLVYCRLH 168
            |..|...:.|.:..:.|.:..||..||.||.|.:.| .|..|..|....:|:.|
  Fly  2140 CFACGFPVEAGDRWVEALNHNYHSQCFNCTFCKQNL-EGQSFYNKGGRPFCKNH 2192

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
LHX2	NP_004780.3	LIM1_Lhx2	43..106	CDD:188853	18/55 (33%)
		LIM2_Lhx2_Lhx9	111..169	CDD:188763	17/58 (29%)
		COG5576	<247..378	CDD:227863
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	250..270
		Homeobox	270..323	CDD:395001
		Nuclear localization signal. /evidence=ECO:0000255	307..323
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	328..374
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	387..406
Zasp52	NP_001027420.2	PDZ_signaling	6..87	CDD:238492
		DUF4749	150..>217	CDD:292558
		LIM_ALP_like	282..333	CDD:188746
		LIM1_Enigma_like_1	2020..2073	CDD:188839
		LIM	2081..2132	CDD:259829	17/52 (33%)
		LIM3_Enigma_like_1	2140..2193	CDD:188845	17/54 (31%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.910