Sequence 1: | NP_004780.3 | Gene: | LHX2 / 9355 | HGNCID: | 6594 | Length: | 406 | Species: | Homo sapiens |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_523670.2 | Gene: | eve / 36039 | FlyBaseID: | FBgn0000606 | Length: | 376 | Species: | Drosophila melanogaster |
Alignment Length: | 196 | Identity: | 51/196 - (26%) |
---|---|---|---|
Similarity: | 82/196 - (41%) | Gaps: | 35/196 - (17%) |
- Green bases have known domain annotations that are detailed below.
Human 221 QKGRPRKRKSPGPGADLAAYNAALSCNENDAEHLDRDQPYPSSQKTKRMRTSFKHHQL-RTMKSY 284
Human 285 FAINHNPDAKDLKQLAQKTGLTKRVLQVWFQNARAKFRRNLLRQENTGVDKSTD----------A 339
Human 340 ALQTGTPSGP----ASELSNASLSPSSTP---TTLTDLTSPTLPTVTSVLTSVPGNLEGHEPH-S 396
Human 397 P 397 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
LHX2 | NP_004780.3 | LIM1_Lhx2 | 43..106 | CDD:188853 | |
LIM2_Lhx2_Lhx9 | 111..169 | CDD:188763 | |||
COG5576 | <247..378 | CDD:227863 | 35/148 (24%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 250..270 | 3/19 (16%) | |||
Homeobox | 270..323 | CDD:395001 | 18/53 (34%) | ||
Nuclear localization signal. /evidence=ECO:0000255 | 307..323 | 7/15 (47%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 328..374 | 10/62 (16%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 387..406 | 6/12 (50%) | |||
eve | NP_523670.2 | Homeobox | 74..126 | CDD:278475 | 18/52 (35%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |