DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LHX2 and Lim3

DIOPT Version :9

Sequence 1:NP_004780.3 Gene:LHX2 / 9355 HGNCID:6594 Length:406 Species:Homo sapiens
Sequence 2:NP_001260559.1 Gene:Lim3 / 35184 FlyBaseID:FBgn0002023 Length:555 Species:Drosophila melanogaster


Alignment Length:389 Identity:115/389 - (29%)
Similarity:164/389 - (42%) Gaps:110/389 - (28%)


- Green bases have known domain annotations that are detailed below.


Human    32 AIDRGD--TETTMPSISSDRA-----ALCAGCGGKISDRYYLLAVDKQWHMRCLKCCECKLNLES 89
            |:|:.|  .|..:..||.:||     ..|.||...|.||:.|..:::.||.:||:|.||...|..
  Fly    94 AVDQDDPNPELVLALISRNRALEATIPKCGGCHELILDRFILKVLERTWHAKCLQCSECHGQLND 158

Human    90 ELTCFSKDGSIYCKEDYYRRFSVQRCARCHLGISASEMVMRARDLVYHLNCFTCTTCNKMLTTGD 154
            :  ||:::|.::||||:::|:.. :|:.|.:||..:::|.||:|.||||.||.|..|::.|.|||
  Fly   159 K--CFARNGQLFCKEDFFKRYGT-KCSACDMGIPPTQVVRRAQDNVYHLQCFLCAMCSRTLNTGD 220

Human   155 HFG-MKDSLVYCRLHFEALLQGEYPAHFNHADVAAAAAAAAAAKSAGLGAAGANPLGLPYYNGVG 218
            .|. |:|..:.|:..:|                        .||:.||           |.:|  
  Fly   221 EFYLMEDRKLICKRDYE------------------------EAKAKGL-----------YLDG-- 248

Human   219 TVQKGRPRKRKSPGPGADLAAYNAALSCNENDAEHLDRDQPYPSSQKTKRMRTSFKHHQLRTMKS 283
                                              .||.|||      .||.||:....||.|:|:
  Fly   249 ----------------------------------SLDGDQP------NKRPRTTITAKQLETLKT 273

Human   284 YFAINHNP-DAKDLK-QLAQKTGLTKRVLQVWFQNARAKFRR-----------NLLRQENTGVDK 335
              |.|::| .|:.:: ||:|.|||..||:||||||.|||.:|           ...|........
  Fly   274 --AYNNSPKPARHVREQLSQDTGLDMRVVQVWFQNRRAKEKRLKKDAGRTRWSQYFRSMKGNCSP 336

Human   336 STDAALQTGTPSGPASELSNASLSPSSTPTTLTDLTSPTLPTVTSVLTSVPGNLEGHEPHSPSQ 399
            .||..|............|:..||..|..|....|.....|      .|:.|:.. |...||||
  Fly   337 RTDKFLDKDELKVDYDSFSHHDLSNDSYSTVNLGLDEGASP------HSIRGSYM-HGSSSPSQ 393

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LHX2NP_004780.3 LIM1_Lhx2 43..106 CDD:188853 25/67 (37%)
LIM2_Lhx2_Lhx9 111..169 CDD:188763 24/58 (41%)
COG5576 <247..378 CDD:227863 46/143 (32%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 250..270 7/19 (37%)
Homeobox 270..323 CDD:395001 27/54 (50%)
Nuclear localization signal. /evidence=ECO:0000255 307..323 11/15 (73%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 328..374 9/45 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 387..406 6/13 (46%)
Lim3NP_001260559.1 LIM1_Lhx3_Lhx4 122..173 CDD:188754 21/52 (40%)
LIM2_Lhx3_Lhx4 181..236 CDD:188762 24/54 (44%)
Homeobox 259..312 CDD:278475 27/54 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.