DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment LHX2 and pdm2

DIOPT Version :9

Sequence 1:	NP_004780.3	Gene:	LHX2 / 9355	HGNCID:	6594	Length:	406	Species:	Homo sapiens
Sequence 2:	NP_001285877.1	Gene:	pdm2 / 34673	FlyBaseID:	FBgn0004394	Length:	893	Species:	Drosophila melanogaster

Alignment Length:	82	Identity:	24/82 - (29%)
Similarity:	44/82 - (53%)	Gaps:	9/82 - (10%)

- Green bases have known domain annotations that are detailed below.

Human   265 KTKRMRTSFKHHQLRTMKSYFAINHNPDAKDLKQLAQKTGLTKRVLQVWFQNARAKFRRNLLRQE 329
            :.::.|||.:.....|::..|.:|..|.::::.||:::..:.|.|::|||.|.|.|.:|
  Fly   785 RRRKKRTSIETTVRTTLEKAFLMNCKPTSEEISQLSERLNMDKEVIRVWFCNRRQKEKR------ 843

Human   330 NTGVDKSTDAALQTGTP 346
               ::.|.|....||||
  Fly   844 ---INPSLDLDSPTGTP 857

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
LHX2	NP_004780.3	LIM1_Lhx2	43..106	CDD:188853
		LIM2_Lhx2_Lhx9	111..169	CDD:188763
		COG5576	<247..378	CDD:227863	24/82 (29%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	250..270		0/4 (0%)
		Homeobox	270..323	CDD:395001	17/52 (33%)
		Nuclear localization signal. /evidence=ECO:0000255	307..323		8/15 (53%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	328..374		6/19 (32%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	387..406
pdm2	NP_001285877.1	POU	691..755	CDD:197673
pdm2	NP_001285877.1	Homeobox	789..842	CDD:278475	17/52 (33%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.910