DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LHX2 and scro

DIOPT Version :9

Sequence 1:NP_004780.3 Gene:LHX2 / 9355 HGNCID:6594 Length:406 Species:Homo sapiens
Sequence 2:NP_001015473.1 Gene:scro / 3355151 FlyBaseID:FBgn0287186 Length:468 Species:Drosophila melanogaster


Alignment Length:412 Identity:88/412 - (21%)
Similarity:141/412 - (34%) Gaps:68/412 - (16%)


- Green bases have known domain annotations that are detailed below.


Human    16 DEMDRRAKSEAPAISSAIDRGDTET-TMPSISSDRAALCAGCGGKISDRYYLLAVDKQWHMRCLK 79
            |.:...|.|:...:.::......|| |..::|:..||..|.....:|..::|..:..| |...| 
  Fly    45 DTLIHTAISQHHQVDTSTKLNTNETSTQNTVSTAAAAAVAHHHHNLSSIHHLQNLHSQ-HQSTL- 107

Human    80 CCECKLNLESELTCFSKDGSIYCKEDYYRRFSVQRCARCHLGISASEMVMRARDLVYHLN---CF 141
                 .| .:..|.||....:...|:.||:..:.       |...|.  .|:......:|   ..
  Fly   108 -----FN-SNHSTPFSVTDILSPIEESYRKLELN-------GNPPSP--FRSNSSSSSINSPGTL 157

Human   142 TCTTCNKMLTTGDHFGMKDSLVYCRLHFEALLQGEYPAHFNHADVAAAAAAAAAAKSAGLGAAGA 206
            |.:|.......|..:.......||.......|.|.|....|.|....:.|.......:.|.::.|
  Fly   158 TTSTMANPYAMGTLYHSPGVQTYCGPTDNLSLAGHYTDMRNSASWYGSTANDPRFAISRLMSSSA 222

Human   207 NPLGLPYYNGVGTVQKGRPRKRKSPGPGADLAAYNAALSCNENDAEHLDRDQPYPSSQKTKRMRT 271
            :          ||:        ...|..:.|||      |:.:|::.|.    :|.:|:.|| |.
  Fly   223 S----------GTM--------SHMGNMSGLAA------CSVSDSKPLQ----FPLAQRRKR-RV 258

Human   272 SFKHHQLRTMKSYFAINHNPDAKDLKQLAQKTGLTKRVLQVWFQNARAKFRRNL-------LRQE 329
            .|...|:..::..|.......|.:.:.||....||...:::||||.|.|.:|..       ..|.
  Fly   259 LFTQAQVYELERRFKQQRYLSAPEREHLASLIHLTPTQVKIWFQNHRYKCKRQAKEKAMAEQNQH 323

Human   330 NTGVDKSTDAALQTGTPSGPASELSNASLSPSSTPTTLTDLTSPTLPT--------VTSVLTSVP 386
            |.........|:......|.....:|:|.......|..|...:.|...        :.||..:|.
  Fly   324 NQPASSPRRVAVPVLVKDGKPCSGNNSSSQSQQHGTNSTSAGNNTGSANNGNANSGIVSVTANVS 388

Human   387 GNLE---GHEPHSPSQTTLTNL 405
            |.|.   |..|:|.|..|.::|
  Fly   389 GGLNLITGDAPNSHSPDTSSSL 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LHX2NP_004780.3 LIM1_Lhx2 43..106 CDD:188853 14/62 (23%)
LIM2_Lhx2_Lhx9 111..169 CDD:188763 9/60 (15%)
COG5576 <247..378 CDD:227863 31/145 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 250..270 6/19 (32%)
Homeobox 270..323 CDD:395001 15/52 (29%)
Nuclear localization signal. /evidence=ECO:0000255 307..323 6/15 (40%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 328..374 8/45 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 387..406 8/22 (36%)
scroNP_001015473.1 Homeobox 256..309 CDD:278475 16/53 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.