DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LHX2 and Bx

DIOPT Version :9

Sequence 1:NP_004780.3 Gene:LHX2 / 9355 HGNCID:6594 Length:406 Species:Homo sapiens
Sequence 2:NP_001259687.1 Gene:Bx / 32846 FlyBaseID:FBgn0265598 Length:424 Species:Drosophila melanogaster


Alignment Length:292 Identity:93/292 - (31%)
Similarity:128/292 - (43%) Gaps:42/292 - (14%)


- Green bases have known domain annotations that are detailed below.


Human     7 SGPEVHG---VIDEMD-------RRAKSEAPAISSAIDRGDTETTMPSISSDRAALCAGCGGKIS 61
            :||..:|   |::.::       ........:|::|.:..:..      :::.:.||||||..|.
  Fly    42 NGPNPNGNGNVVNVVNSGGAGGGNNGNGNVQSIAAAANNNNNN------NNNGSQLCAGCGKHIQ 100

Human    62 DRYYLLAVDKQWHMRCLK--CCECKLNLESELTCFSKDGSIYCKEDYYRRF-SVQRCARCHLGIS 123
            |||.|.|:|..||..|||  ||:|:|. |...|.::|...:.||.||.|.| :...||.|...|.
  Fly   101 DRYLLRALDMLWHEDCLKCGCCDCRLG-EVGSTLYTKGNLMLCKRDYLRLFGNTGYCAACSKVIP 164

Human   124 ASEMVMRARDLVYHLNCFTCTTCNKMLTTGDHFGMKDSLVYCRLHFEALL----QGEYP---AHF 181
            |.|||||||..||||.||.|..||.....||.|.:.::.:.|...:|..|    ...:|   .|.
  Fly   165 AFEMVMRARTNVYHLECFACQQCNHRFCVGDRFYLCENKILCEYDYEERLVFASMANHPMLKRHV 229

Human   182 NHADVAAAAAAAAAAKSAGLGAAGANPLGLPYYNGVGTVQKGR---PRKRKSPGP------GADL 237
            :.....:...||.|..:|| |..|..| |....||||.|...|   .....:.||      |:..
  Fly   230 SSLGQGSPTGAAGAQNTAG-GLLGGGP-GGGNVNGVGMVNGPRTPGDHNNNNNGPQTPTGGGSPF 292

Human   238 AAYNAALSCNENDAEHLDRDQPYPSSQKTKRM 269
            ||..||.:.    |.|:.......| .|...|
  Fly   293 AAAAAAAAA----AAHMKNQLGASSXNKALGM 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LHX2NP_004780.3 LIM1_Lhx2 43..106 CDD:188853 27/64 (42%)
LIM2_Lhx2_Lhx9 111..169 CDD:188763 25/57 (44%)
COG5576 <247..378 CDD:227863 5/23 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 250..270 5/20 (25%)
Homeobox 270..323 CDD:395001 93/292 (32%)
Nuclear localization signal. /evidence=ECO:0000255 307..323
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 328..374
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 387..406
BxNP_001259687.1 LIM1_LMO1_LMO3 92..146 CDD:188774 26/54 (48%)
LIM2_dLMO 156..210 CDD:188776 25/53 (47%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.