DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment LHX2 and CG34325

DIOPT Version :9

Sequence 1:	NP_004780.3	Gene:	LHX2 / 9355	HGNCID:	6594	Length:	406	Species:	Homo sapiens
Sequence 2:	NP_001097003.1	Gene:	CG34325 / 32656	FlyBaseID:	FBgn0085354	Length:	179	Species:	Drosophila melanogaster

Alignment Length:	121	Identity:	36/121 - (29%)
Similarity:	56/121 - (46%)	Gaps:	7/121 - (5%)

- Green bases have known domain annotations that are detailed below.

Human    47 SDRAALCAGCGGKISDRYYLLAVDKQWHMRCLKC-CECKLNLESELTCFSKDGSIYCKEDYYRRF 110
            |:.:.:|.||...|.:| .:.|:.:.||..|..| ..|...|... :.:..||..||:.|:...|
  Fly    61 SNYSGICHGCKRPILER-TIKAMGETWHEECFLCRGPCMQQLAGS-SFYEHDGLPYCRTDFEHMF 123

Human   111 SVQRCARCHLGISASEMVMRARDLVYHLNCFTCTTCNKMLTTGDHFGMKDSLVYCR 166
            :. ||..|...|:.:.:|  |.|..:|..||.|..| |...|...|.::|:...|:
  Fly   124 AA-RCGNCKAPITENAIV--ALDAKWHRECFKCKKC-KTPITASSFVVEDNQPLCK 175

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
LHX2	NP_004780.3	LIM1_Lhx2	43..106	CDD:188853	17/59 (29%)
		LIM2_Lhx2_Lhx9	111..169	CDD:188763	17/56 (30%)
		COG5576	<247..378	CDD:227863
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	250..270
		Homeobox	270..323	CDD:395001
		Nuclear localization signal. /evidence=ECO:0000255	307..323
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	328..374
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	387..406
CG34325	NP_001097003.1	LIM	8..59	CDD:295319
		LIM	67..119	CDD:295319	16/53 (30%)
		LIM	127..175	CDD:295319	15/50 (30%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.910