DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment LHX2 and Zyx

DIOPT Version :9

Sequence 1:	NP_004780.3	Gene:	LHX2 / 9355	HGNCID:	6594	Length:	406	Species:	Homo sapiens
Sequence 2:	NP_652015.1	Gene:	Zyx / 317824	FlyBaseID:	FBgn0011642	Length:	585	Species:	Drosophila melanogaster

Alignment Length:	129	Identity:	37/129 - (28%)
Similarity:	63/129 - (48%)	Gaps:	14/129 - (10%)

- Green bases have known domain annotations that are detailed below.

Human    31 SAIDRGDTE--------TTMPSISSDRAALCAGCGGKI-SDRYYLLAVDKQWHMRCLKCCECKLN 86
            ::|.|.|.|        .|.|....:....|..|..:: .:.....|:|:.:|:.|..|.:|::|
  Fly   358 NSIHRNDKEGLKNYISIPTEPVQELENYGRCVKCNSRVLGESSGCTAMDQIYHIFCFTCTDCQIN 422

Human    87 LESELTCFSKDGSIYCKEDYYRRFSVQRCARCHLGISASEMVMRARDLVYHLNCFTCTTCNKML 150
            |:.: ..::.||..||:.||.:  ::::|:.|...|  .|.::||....||..||||..|.|.|
  Fly   423 LQGK-PFYALDGKPYCEYDYLQ--TLEKCSVCMEPI--LERILRATGKPYHPQCFTCVVCGKSL 481

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
LHX2	NP_004780.3	LIM1_Lhx2	43..106	CDD:188853	15/63 (24%)
		LIM2_Lhx2_Lhx9	111..169	CDD:188763	15/40 (38%)
		COG5576	<247..378	CDD:227863
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	250..270
		Homeobox	270..323	CDD:395001
		Nuclear localization signal. /evidence=ECO:0000255	307..323
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	328..374
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	387..406
Zyx	NP_652015.1	LIM1_LPP	388..441	CDD:188737	14/53 (26%)
		LIM2_LPP	448..507	CDD:188740	15/36 (42%)
		LIM3_LPP	508..575	CDD:188821
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.910