DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LHX2 and Unc-115a

DIOPT Version :9

Sequence 1:NP_004780.3 Gene:LHX2 / 9355 HGNCID:6594 Length:406 Species:Homo sapiens
Sequence 2:NP_001163573.1 Gene:Unc-115a / 261629 FlyBaseID:FBgn0051352 Length:844 Species:Drosophila melanogaster


Alignment Length:518 Identity:109/518 - (21%)
Similarity:167/518 - (32%) Gaps:192/518 - (37%)


- Green bases have known domain annotations that are detailed below.


Human    24 SEAPAISSAIDRGDTETTMPSISSDRAAL--------CAGCGGKISDRYYLLAVDKQWHMRCLKC 80
            |.||...|. .|........|:.|.:|.|        |||||..:.:...|:|:|:|||:.|.:|
  Fly   175 SPAPPAESP-TRATAHQQHGSVISHKAHLKEDYDPNDCAGCGELLKEGQALVALDRQWHVSCFRC 238

Human    81 CECKLNLESELTCFSKDGSIYCKEDYYRRFSVQRCARCHLGISASEMVMRARD-LVYHLNCFTCT 144
            ..|:..|..|.  ..||...||::.|.:.|.| :||.|...||..  |::|.| ..:|..|..||
  Fly   239 KACQAVLNGEY--MGKDAVPYCEKCYQKGFGV-KCAYCSRFISGK--VLQAGDNHHFHPTCARCT 298

Human   145 TCNKMLTTGDHFGMKDSLVY-------------------------------------C------- 165
            .|......|:...::.|.::                                     |       
  Fly   299 KCGDPFGDGEEMYLQGSAIWHPRCGPGPSESGIILNGGGGTSSVVGGASNGNFTDTECDRMSSSA 363

Human   166 ---------------------RLHFEALLQG----EY---------------------------- 177
                                 |.|:..:..|    ||                            
  Fly   364 LSEMYIRSRTPSFNGSLYSSSRKHYRTVSPGLILREYGRPNAEDISRIYTYSYLTDAPHYLRKPI 428

Human   178 --------PAHFNHADVAAAAAAAAAAKSAGLGAAGANPLGLPYYNG-------VGTVQKGRPRK 227
                    ..||:.     .::.|..|.:|| ..||:.|...|:...       |..::...||.
  Fly   429 DPYDKTPLSPHFHR-----PSSYATTASNAG-SVAGSRPPSRPHSRTRSAMKVLVDAIRSETPRP 487

Human   228 RKSPGPG----ADLAAYNAALSCNENDAEHLDRDQ----PYPSSQKTKRMRTSFKHHQLRTMKSY 284
             ||||..    .:|:.|.||......:...::||.    |||.:...:|.|.|         .:|
  Fly   488 -KSPGMNNEEPIELSHYPAAKKPPPGEQPKIERDDFPAPPYPYTDPERRRRYS---------DTY 542

Human   285 FAINHNPDAKDLKQLAQKTGLTKRVLQVWFQNARAKFRRNLLRQENTGVDKSTDAALQTGTPSGP 349
            ..:..:.|..:..:..:..|..|        |...:.|   |::|...::|     |.:|..|..
  Fly   543 KGVPASDDEDENVENGKPNGKVK--------NGEEQQR---LQREAEQLEK-----LNSGIGSAI 591

Human   350 ASELS----------------NASLSPSSTPTTLTDL--TSPTLPTVTSVLTSVPGNLEGHEP 394
            |.:|.                |||.:||::...|..|  .||       :..|...||:..:|
  Fly   592 AKDLKEHAKYRKWKQNNLDPRNASRTPSASKEPLYKLRYESP-------IGASPSRNLDHQKP 647

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LHX2NP_004780.3 LIM1_Lhx2 43..106 CDD:188853 24/70 (34%)
LIM2_Lhx2_Lhx9 111..169 CDD:188763 18/123 (15%)
COG5576 <247..378 CDD:227863 31/152 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 250..270 6/23 (26%)
Homeobox 270..323 CDD:395001 7/52 (13%)
Nuclear localization signal. /evidence=ECO:0000255 307..323 2/15 (13%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 328..374 15/63 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 387..406 3/8 (38%)
Unc-115aNP_001163573.1 LIM1_abLIM 46..97 CDD:188713
LIM2_abLIM 102..157 CDD:188714
LIM3_abLIM 211..262 CDD:188715 20/52 (38%)
LIM4_abLIM 270..326 CDD:188716 15/57 (26%)
AbLIM_anchor <783..808 CDD:292800
VHP 810..844 CDD:280388
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.