DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LHX2 and CG30178

DIOPT Version :9

Sequence 1:NP_004780.3 Gene:LHX2 / 9355 HGNCID:6594 Length:406 Species:Homo sapiens
Sequence 2:NP_726395.1 Gene:CG30178 / 246501 FlyBaseID:FBgn0050178 Length:187 Species:Drosophila melanogaster


Alignment Length:162 Identity:43/162 - (26%)
Similarity:69/162 - (42%) Gaps:18/162 - (11%)


- Green bases have known domain annotations that are detailed below.


Human     4 HSLSGPEVHGVIDEMDRRAKSEAPAISSAIDRGDTETTMPSISSDRAALCAGCGGKISDRYYLLA 68
            |..:..|...|:|          |.:..|:|  |............||.|:.|...|.:| .:.|
  Fly    28 HHFTCKECGLVVD----------PKLFFAVD--DDVVCSECYLDKHAARCSACRTPILER-GVAA 79

Human    69 VDKQWHMRCLKCCECKLNLESELTCFSKDGSIYCKEDYYRRFSVQRCARCHLGISASEMVMRARD 133
            .:::||.:|.:|..|..:|.| .:.|..:|.::||..:...|| .|||.|...|....:|  |..
  Fly    80 AERKWHEKCFRCVSCSKSLVS-ASFFEVNGYLFCKAHFRELFS-SRCAGCEKPIDRRAVV--ALS 140

Human   134 LVYHLNCFTCTTCNKMLTTGDHFGMKDSLVYC 165
            ..:|..||.|..|.|.::..: |.:::....|
  Fly   141 TKWHAKCFKCHHCRKRISARE-FWIENGQPIC 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LHX2NP_004780.3 LIM1_Lhx2 43..106 CDD:188853 18/62 (29%)
LIM2_Lhx2_Lhx9 111..169 CDD:188763 16/55 (29%)
COG5576 <247..378 CDD:227863
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 250..270
Homeobox 270..323 CDD:395001
Nuclear localization signal. /evidence=ECO:0000255 307..323
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 328..374
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 387..406
CG30178NP_726395.1 LIM 6..61 CDD:295319 8/44 (18%)
LIM 65..116 CDD:259829 16/52 (31%)
LIM 124..171 CDD:295319 13/49 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.